Global Closure Systems Is Glad To Announce That The Group Will Be Exhibiting At Cphi 2014 In Paris From October 7th To October 9th 2014 Booth 2f57with Its Well Established Product Ranges As Capepharmareg Cliclocreg Medilocreg Pharmasafereg And Vistopreg And Its Large Portfolio Of More Than 130 References Gcs Is A Leading Manufacturer Of Child Resistant Closures Tamper Evident Closures Dosing Devices And Droppers In Europegcs Provides Closures Solutions For Pharmaceutical Applications To Many Of The Major Companies In The Otc And Ethical Sectorsgcs Will Present Its Unique Expertise And Its Latest Innovations In A Broad Range Of Products Including Medical Devicesmeet Gcs Sales And Rampd Teams And Talk With Us About Your New Product Development Needs We Look Forward To Seeing Youabout Global Closure Systemswith Consolidated Revenue Of Euro583 Million In 2013 And Approximately 3 500 Employees Global Closure Systems Is One Of The Worldrsquos Largest Providers Of Closure Solutions For The Fmcg Market Thanks To Its 21 Production Sites Strategically Located In 13 Countries All Around The World Gcs Manufactures Close To 40 Billion Plastic And Metal Closures Per Annum Gcs Offers Over 2 000 Designs Of Standard And Custom Closures And Dispensing Systems For The Global Beverage Food Health Care Household Amp Industry Personal Care And Wine Amp Spirits Marketswwwgcscom

At This Yearrsquos Congress Of The European Tube Manufacturers Association Etma In Milan A Jury Comprising Association Members Selected Winners In The Aluminium Tubes Plastic Tubes Laminate Tubes And Prototypes Categories The Experts Were Particularly Impressed By The Innovative Solutions In The Form Of Small Tubes And The Excellent Examples Of Exceptional Design And Fantastic Printing Qualitythe Winner Of The Aluminium Tube Category Was The Igora Hair Coloration Tube Which Was Produced By Tubex Wasungen Of Germany The Colour Of The Tube Changes In Extremely Fine Gradations From Orange On The Reverse Of The Tube To A Fascinating Pink On The Front The Combination Of Aluminium And Unique Colours Produces The Dazzlingly Iridescent Colour Gradient The Brand Name Is In Reversedout Printing And The Shimmering Aluminium Literally Puts On A Glittering Performance For The Brand Swinging And Dynamic Lively And Exciting And Thus A Perfect Fit For The Igora Vibrance Product Rangethe First Place In The Laminate Tube Category Went To The Axe Peace Tube From Essel Deutschland For Unileverrsquos European Product Launch Here The Jury Was Impressed By The Transparent Window At The End Of The Tube The Absence Of Any Disruptive Side Seam Thanks To 360deg Inviseam Technology The High Covering Power Of The Inks In The Nontransparent Areas And The Unusual Design Of The Welded Tube End The Tube Was Manufactured From A Transparent Laminate With A Plastic Barrier The Printing Is The Result Of A Combination Of Flexo And Screen Printing Processes With Additional Special Metallic Silver Printing For The Axe Logo And Other Design Elementsthe Dermophil Expert Soin Universel Smallformat Tube From Albeacutea Took Home The First Prize For Plastic Tubes With Its My Little Cap The French Tube Manufacturer Offers The Smallest Fliptop Cap Currently Available On The Market Dermophil Expert Commissioned The Development Of The Snapon Fliptop Cap Which Is Suitable For Tubes Of 16 And 19 Mm Diameter For Its Soin Universel Product Series This Special Appearance Means These Tubes Also Perfectly Match The Larger Tubes In The Series And Thus Give The Whole Product Range A Uniform Look The Caprsquos Very High Pulloff Force Makes The Tube Childproof It Can Also Be Opened And Closed Again Easily With One Hand And Is Ideal For Smaller Packs For Travel Product Samples Promotions And Any Applications Requiring A Small Dosea Solution For An Extremely Small Tube Also Won Through In The Prototypes Category With Its Miniwing Closure Hoffmann Neopac Of Switzerland Presented An Ergonomic Cap Solution For Smaller Tube Formats With Diameters From 10 To 25 Mm Customers Often Have Difficulty Opening And Closing Such Small Tubes The Miniwing Solution Helps Here Thanks To Small Reinforcements On The Cap Consumers Can Better Grip And Turn It And Their Hands Do Not Slip Off So Easily The Miniwing Closure Fits All Standard Nozzle Heads And All Dropper Tubes To Give Welldosed And Precise Applicationgregor Spengler Etmarsquos Secretary General Was Pleased With The Quality Of The Entries And The Decision Of The Jury Ldquothe Winning Tubes Make Clear Where The Journey Is Heading And That Can Be Taken Literally Here Ever Greater Mobility Is Fuelling The Trend Towards Smaller And Extremely Small Packs And The Tube Is Simply Perfectly Placed For Such Applications Being Stable And Unbreakable With High Standards Of Hygiene And The Best Barrier Properties For Optimal Product Safety Innovations Are Leading To Better Handling And Added Convenience Today One No Longer Has To Forego Onersquos Usual Products When Travelling This Strengthens A Brand And Encourages Product Loyalty Furthermore Exciting Designs And Unbelievable Print Quality Produce Sensational Appearances At The Point Of Sale And A Great Brand Presencerdquoduumlsseldorf 18092014specimen Copy Requestedyour Contactgregor Spengleretma Secretary Generalhead Of Packaging In Gesamtverband Der Aluminiumindustrie Gda

Ampac The Worldrsquos Leader In Creative Packaging Solutions Announces A New Series Of Tamperevident Closures For Its Keepsafereg Tamperevident Product Rangeampac And Its Keepsafe Brand Of Products Remains The Industry Leading Producer Of Tamperevident Packaging As Such Ampac Is Announcing Improved Market Alignment Of Its Keepsafe Closures Ampac Introduces Keepsafe Ultra Formerly Gold Keepsafe Premium Formerly Silver And Keepsafe Secure Formerly Bronze Closures In Response To A Lack Of Polarization Between Highlevel And Midlevel Closures In The Marketplaceampacrsquos Product And Innovation Teams Have Engineered A Midlevel Closure Ndash Keepsafe Premium Ndash That Voids Against Heat Cold And Solvent Keepsafe Premium Is A Permanent Adhesive Closure Intended For Users With Moderaterisk Applications Such As Direct To Branch Deposits Armored Courier Deposits Internal Cash Management Secure Document Transport And More This Game Changing Solution Provides More Security Features Than Its Predecessor Keepsafe Silver By Reducing Overall Production Costs And Creating More Value To Customersin Addition To Providing An Innovative Solution For Midlevel Tamperevident Bags Ampacrsquos Highlevel Closure Ndash Keepsafe Ultra Ndash Has Been Redesigned To Incorporate Security Features Unique To The Market Including Die Cuts That Cause The Closure To Tear When Mechanically Peeled Keepsafe Ultra Is Intended For Customers With Highrisk Applications Such As Cashintransit Providers Financial Institutions And Pharmaceutical Distributors Keepsafe Ultra Will Continue To Void Against Heat Cold Solvents And Moisturesep Italiano Ampacrsquos Global Vice President Of Sales States Ldquothe Much Improved Security Closure Line Is A True Alignment To The Needs Of The Market Providing A Solution In The Midlevel Range Of Risk With Our Keepsafe Premium Closure Allows Ampac To Provide Additional Tamperevident Features And Added Cost Savings To Our Retail Customers The New Robust Highlevel Keepsafe Ultra Tamperevident Closure Allows Customers With Greater Risk Of Loss To Respond To More Advanced Methods Of Compromise Seen In The Market Todayrdquonbsphttpwwwampaconlinecomaboutmedianewspressampacannouncesnewkeepsafeclosurestamperevidentpackaging

Twinsburg Oh Ndash Pepperlfuchs Introduces The New Compact F190 Uhf Readwrite Head The F190 Features A Robust Sealed Metal Housing And A Compact Footprint For Reliable Operation In Adverse Environmental Conditions And Simple Installation Even In Tight Spaces Because Several Products In A Container Can Be Detected At The Same Time Using Multitag Reading The F190 Simultaneously Simplifies Processes And Reduces Processing Time The F190 Easily Integrates Into Existing Identcontrol Systems Enabling Users To Connect To Standard Protocols Such As Ethernetip Profinet Tcpip And Ethercat Three Reader Versions Are Available To Cover Worldwide Operationnbspldquoin The Field Ofnbspintralogistics Efficiency Is The Number One Priority Goods Have To Be Distributed Quickly And Reliably And Forwarded To Their Intended Destinationnbspwithout Any Allocation Errors The New Generation Of F190 Uhf Readwrite Head Opens Up Anbspwealth Of Opportunities For Thenbsplogistics Sectornbspand Thenbspautomotive Industry For Examplerdquo Says Tim Cicerchi Product Marketing Managernbspparticularly Costefficient Uhflabels Are Directly Attached To The Products When These Uhf Labels Move Into The Read Field Of The F190 The Label Informationnbspis Transmitted To The Read Head And Then To The Identcontrol Interface Where Previously The Data Was Transmitted For Each Tag Individually The F190nbsptransmits Data In Bundles This Enables Information Fromnbspup To 40 Tagsnbspto Be Transmitted To The Read Head In A Single Stepnbspthe F190 Uhf Rfid Reader Boasts A Typical Read Range Of 02 Up To 15 Meters It Also Accommodates Linear Vertical Linear Horizontal Or Circular Polarization The Advantage Of Circular Polarization Is That A Tag Can Be Read In Any Orientation While Linear Polarization Provides More Power In A Known Tag Orientation The Unit Connects To The Controller With A Standard Industrial M12 Connector The Read Head Can Be Connected 100 M Away If Required Additionally An Innovative Powersweep Mode Lets Users Set A Predetermined Number Of Tags To Be Read The Power Is Then Slowly Ramped Up Until All The Tags Are Read And The Reader Is Then Shut Off Until The Next Read Cyclenbspno Middleware Is Required So The F190 Communicates Directly With Plc Control Systems From Allen Bradley Siemens And Many Others Even Though No Extra Software Is Required A Free Demo Program Rfidcontrol Can Be Used To Setup And Test The Systemnbsppepperlfuchs Is A World Leader In The Design Manufacture And Application Of High Quality Factory And Process Automation Products And Services Pepperlfuchs Pioneered The Development Of Proximity Sensors 50 Years Ago And Has Set The Standard For Innovation And Quality Ever Sincenbspnbsppepperlfuchs 1600 Enterprise Parkway Twinsburg Oh 44087 330 4860001 Fax 330 4054710 Fainfouspepperlfuchscom Wwwpepperlfuchsusnbspnbspfor Lead Processing Email Or Send All Leads To Tmaleyuspepperlfuchscom Pepperlfuchs 1600 Enterprise Parkway Twinsburg Oh 44087 Attn Tonya Maley Please Identify Leads With Item Code Pfa723 For Fastest Lead Processingnbsp

Optima Is Exhibiting The Very Latest Service Technologies At Pack Expo The Central Constituent Part Of Quottcamquot Total Care Asset Management Is The Condition Monitoring System Of Optima Tcam Can Be Upgraded With A Centralised Digital Information Tool With The Additional Benefit Of Augmented Reality Additionally Optima Consumer Is Displaying The New Highperformance Optima Cbf Cartonernbspat Pharma Expo Optima Pharma Ndash Vendor Of Leadingedge Filling Closing And Process Technologies Ndash Is Exhibiting A Compact Machine With A Threeway Function In The Form Of The Inova Ekcs In Addition To Labelling Plungers Are Inserted Into Syringes And Finger Grips Installed Metall Plastic Will Be Putting The Gts Glove Testing System On Display The Device Is Characterised By A High Degree Of Flexibility Since Corresponding Test Covers Can Be Offered For Just About Any Type Of Glove And Glove Ringnbspattached You Will Find The Press Release And Picture For Your Consideration In The Editorial Part Of Your Publicationnbspkind Regardsnbspoptima Packaging Group Gmbhsabine Gaugermarketing Director49 0791 5061410sabinegaugeroptimagercomnbspoptima Packaging Group Gmbhfelix Henningpublic Relations49 0791 5061464felixhenningoptimagercomnbspnbspoptima Pack Expo 2014nbspnbspnext Level Service And Leadingedge Packaging Technologynbspoptima Ndash A Leading Manufacturer Of Packaging Lines Ndash Is Exhibiting The Very Latest Service Technologies At Pack Expo The Central Constituent Part Of Quottcamquot Total Care Asset Management Is Tcap Total Care Asset Package The Condition Monitoring System Of Optima The State Of The Machine Is Monitored Constantly By Means Of Electronics And Sensors A Warning Is Given Automatically Even Before Errors Occur It Is Possible To Almost Completely Eliminate Unplanned Downtime Of The Machine This Of Course Means An Increase In Line Efficiency The Amount Of Time Required For Service Is Minimised Through The Very Good Ability To Plan Aheadnbsptcam Can Be Upgraded With Tcat Total Care Asset Tool A Centralised Digital Information Tool The Finding Of Information Is Enormously Simplified And Accelerated By Means Of The Camera And Scan Functions Of A Tablet Pc Significantly More Information Is Available To Be Called Up Interactive Links Between The Electrical Mechanical And Pneumatic Systems Information Are Integrated In Addition Direct Linking To Sap Or Other Erp Systems Means That The Inventory Stocks Of Spare Parts Can Be Retreived And Orders Can Be Initiated Directlynbspnbspoptima Consumer Is Displaying The New Highperformance Optima Cbf Cartoner This Bridges The Gap Between Primary And Secondary Packaging For Perfect Line Integration The Products Fed To The Machine Are Aligned And Placed Within The Cartoner The Flexible Structure Also Makes A Most Convincing Impression Product Grouping Devices Or A Second Erecting Module Can Be Integrated The Cartoner Has A Magazine For Precut Blanks Which Is Replaced As A Unit When The Format Is Changed The Especially Gentle Handling Process In Which Finished Cartons Are Transported In Pucks The Large Format Range The Good Ergonomics And The Hygienic Properties Are Further Advantagesnbspoptima Consumer Will Provide Information On Packaging Solutions For Food Cosmetics And Chemicals The Packaging Lines Of The Company Process Various Products Liquids With High And Low Viscosities Powders And Granules Portioned Packages Or Large Containers Everything From Coffee Capsules To Mascara Sticks To Oil Canisters The Packaging Lines Of Optima Nonwovens Being Presented Contain Technologies For The Packaging Of Paper Hygiene Articles At The Highest Level Automated Complete Lines Can Be Set Up In Combination With Monitoring And Secondary Packing Functions And Palletising Linesnbspoptima At Pack Expo Chicago North Upper Hall Booth 6121nbspnbspoptima Pharma Expo 2014nbspnbsphightech To The Smallest Detailnbspoptima Pharma Is A Vendor Of Leadingedge Filling Closing And Process Technologies For Sterile And Nonsterile Medications At Pharma Expo The Company Is Exhibiting A Compact Machine With A Threeway Function In The Form Of The Inova Ekcs In Addition To Labelling Plungers Are Inserted Into Syringes And Finger Grips Installed The Applied Force Is Constantly Measured And Recorded During The Assembly Operations Transport Within The Machine Is Done Extremely Gently Without Any Glass To Glass Contact Assembly Functions For Additional Components And Camera Systems Can Be Integrated As An Option The Machine That Flexibly Handles A Variety Of Formats Achieves A Capacity Of Up To 3200 Syringes An Hournbspmetall Plastic Will Be Putting The Gts Glove Testing System On Display The Device Is Characterised By A High Degree Of Flexibility Since Corresponding Test Covers Can Be Offered For Just About Any Type Of Glove And Glove Ring Two Independently Operating Builtin Compressors Allow Up To 6 Gloves To Be Tested In Just 15 Minutes An External Compressed Air Supply Is Not Required Any Chance Of Confusion Over Which Glove Data Is Being Recorded Is Excluded By The Use Of Rfid Radio Frequency Identification Chips Once They Have Been Assigned The System Recognises By Itself Which Glove Has Just Been Tested Once The Testing Is Finished A Test Report Can Be Generated And Displayed On The 15quot Touchscreen It Can Also Be Sent Via The Wlan Wireless Module And Merged With Production Batches With No Risk Of Manipulationnbspoptima Pharma Will Be Presenting Information On The Latest Technologies Concerning The Processing Of Medications In Ready To Use Syringes Vials Infusion Bottles And Carpules In Addition To Filling And Closing Further Functions And Process Technologies Including Washing Machines Sterilisation Tunnels And Containment Systems Are Considered Pharmaceutical Freezedrying And Robotics For Product Handling Round Out The Comprehensive Portfolionbspoptima Pharma At Pharma Expo Chicago West Hall Booth 921nbspnbspnbsp

On Wednesday November 19th Nvc Netherlands Packaging Centre Will Together With Comexposium Be Organising A Lecture In Pack Vision Hall 6 At The International Packaging Exhibition Emballage In Paris About The Cooperation In Packaging Between France And Other European Countries Lsquowhy Europe Needs France Ndash And France Needs Europe Ndash In Packagingrsquonbsppackaging Is Temporarily Integrating An External Function And A Product To Enable The Use Of The Product France Plays An Important Role In Packaging Based On Its Position In A Range Of Important Sectors Of Product Manufacturing Logistics Retailing And Packaging Manufacturing Even More Important France Is Globally Known For Its Cultural Heritage And Associated Views On Design And Qualitynbspthis Lecture Elaborates On The Synergies Between France And The Whole Of Europe Addresses The Current Situation And Probes Into The Future Of Packaging From A Frencheuropean And Europeanfrench Perspectivenbspemballage Will Be Held At Paris Nord Villepinte From 17th To 20th November 2014emballage Will Welcome 1500 Exhibitors And 100000 Professional Visitorsemballage Is A Generalist Exhibition And Has A Unique And Complete Offering Process And Packaging Machines Primary Materials Consumables And Films Identification Traceability Marking Coding Machines Secondary Tertiary And Shipping Machines Converting Printing Packaging And Labelling Packaging And Containers Cardboard Plastic Glass Metal Woodnbspfor Press Credentials And Further Details Httppressall4packcomfor More Information About The Exhibition Download The Mobile Application Or Wwwall4packcomfor More Information About The Lecture Please Contact Michael Nieuwesteeg Mnieuwesteegnvcnl 310182512411

New Delhi 5th September 2014 Packagingconnectionscom Is One Of The First Packaging Outsourcing Company To Be Established In India Packagingconnections Has A 9 Year Long Success To Its Credit As A Packaging Outsourcing Company Providing Technical Consultancy In This Niche Field In India And Worldwidenbspnbspoutsourcing Has Been Part Of Our Life From When We Have Known Either At Home Or At Work Outsourcing Has Always Played A Big Role Manufacturing And Import And Exports Have Been Practiced Long But The Extension To Services Is A Relatively New Phenomenon Service Outsourcing Started In India In Mid 1980rsquos And Has Grown Rapidly Accelerated In 1990s In Form Of Bporsquos And Kporsquosnbspnbsppackagingconnections Has Been Working On Different Consultancy Projects On Outsourcing And In The Same Have Partnered With Experts From The Industry Companies For Many Projectsnbspbull Carton Design House To Offer End Users A Complete Packaging Solution From Design To Implementation With Services Like Point Of Purchase Dispensers Point Of Sale Displays Shelf Ready Packs For Modern Tradenbspbull Top Artwork And Design Company For Primary And Secondary Packagingnbspmoving One Step Ahead Towards Partnering For Ldquopackaging Testing Servicesrdquo And Look For Companies Testing Laboratories That Can Join Handsnbspmr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom Said Ldquonow That Packaging Is Gaining The Needed Impetus We Are Looking For Expertise From The Industry Who Can Be Our Partners We Intend To Keep The Impetus In 2014 And In Years To Come And Bring World Class Services Products And Capabilities Through New Alliances And Partners Our Years Of Experience In Working Closely With Manufacturing Innovation And Research Teams From Across The Globe Makes Us An Ideal Partner For Collaboration We Believe We Can Align Our Goals With Our Partners To Revolutionize The Packaging Industryrdquonbspto Know More About This Write Us At Infopackagingconnectionscomnbspnbspvisit Us At Httpwwwpackagingconnectionscomnbspnbspabout Packaging Connectionswwwpackagingconnectionscom Providing Online Packaging Services And Consultancy Worldwidewwwpackagingconnectionscom Has Its Expertise In Technical Packaging Solutions With Powerful Project Management Skills Coordinate The Whole Project With Designer Vendor And Stakeholders Successful Handling And Implementing Projects On Outsourcing Model Is Their Specializationan Entrepreneurial Company Started By Young But Experienced Packaging Technologist Mr Sandeep Goyal Who Has Worked With Leading Mncs Amp Indian Companies Both As A User And A Supplier Of Packaging Materials From Its Inception The Company Was Powered With An Ultimate Vision To Be A Common Packaging Platform To Connect Professionals From All Across The Globe In Order To Realize This Dream Packaging Connections Has Continuously Strived To Bring The Latest Resources From All Over The World To The Doorstep Of Packaging Industrythe Portal Offers Resources Like Buyer And Seller Offers Pinterviews Innovations Key Decision Maker Direct Contacts Online Reports And Other Promotional Services To Provide A Onestop Shop To Buyers Sellers Users Amp Professionals It Helps To Find Out Newer Business Opportunities In India Amp Worldwide With 24 X 7 Days Online Access Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promote Direct Interaction Among Members Amp Visitors Backed By Years Of Industry Experience The Company Has Created Cutting Edge In Offering Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training The Reason For Their Accelerated Growth Is Their Technical Experts And Professionals Who Have Vast Amp Practical Experience And Knowledge About The Industry Their Innovative Solutions And Customized Services Have Shown The Way To Growth And Prosperity They Have Achieved A High Level Of Client Appreciation By Understanding Their Requirements And Exceeding Their Expectationspackaging Connections Is Your Instant Single Point Source For Everything Connected To Packaging Directly Or Indirectly Without Using Any Middlemen Exclusive Integrated And Enhanced Contacts On Everything In Packaging Buyers Suppliers User Companies Professionals Packaging Technology Softwarersquos And Much More With Complete Skills And Knowhow Of The Essentials Of The Packaging Industry And The Requirements Of The Clientsnbspfor Further Details Contactamita Venkateshassociate Ndash Scientific Affairs And Consultancyamitavenkateshpackagingconnectionscomnbsptel Nbsp91 124 4965784nbspnbspnbsp

Next September 18 2014 Xflex X2 Will Demonstrate Its Potential To South African Label Converters At Customer Label Link Of Cape Townomet And Its Representative For South Africa Presstec Announce The Organization Of An Open House Next September 18 At Customer Label Link Of Cape Town Whose Owner Mr Stemmet Has Accepted To Open Doors And Make Its Xflex X2 Available For Demonstrationsxflex X2 Has Been Designed To Reduce Setup Times And Waste To A Minimum And Make The Operatorsrsquo Work As Easy As Possible In Fact Traditional Equipment Like Printing Cylinders Coexist With Ometrsquos Most Advanced Innovations Offered As Standard On The Press The Shortest Web Path Available On The Market A Quick Ink Change System And Chilled Drums Which Make It Possible For Converters To Switch Between Selfadhesive And Flexible Film Printing As Low As 12 Microns The Electronic Equipment Of Xflex X2 Include Cross Printing Registration Adjustments And Printing And Diecutting Automatic Preregister All This In Addition To The Machine Top Quality Components And Peculiar Robustness Allow To Achieve The Highest Quality And Make Of Xflex X2 The Ideal Press For All The Companies Who Do Not Look For Extreme Production Automationthe Xflex X2 Line At Label Link Is 370mm Wide With 8 Uv Flexo Colors Cold Foil And Diecutting The Day Will Start With The Warm Welcome By Presstec Followed By The Introduction To Ometrsquos Range Of Machines By Sergio Villa Omet Regional Manager The Attendees Will Be Then Invited To Assist To Demos On Different Materials And Print Subjects Past Demo Time It Will Be Possible To Schedule Onetoone Meetings With Presstec And Ometrsquos Representatives Both Companiesrsquo Staff Will Be On Hand For The Duration Of The Event To Answer To Any Technical Or Commercial Questionit Is The First Official Presentation Of Xflex Line Of Packaging Printing Machines In South Africa And The Very First Event Of This Kind With A Customer Opening Its Factory To Other Converters This Is Going To Be Possible Thanks To The Great Confidence Established Between The Agent And Omet And The Agent And The Customer Presstec Team Antron And Linton Hendricks In The First Place Have Shown Great Ability In Dealing With The Customers And A Deep Knowledge Of The Local Market Both Abilities Have Contributed To The Signing Of Two Orders In A Quite Short Timeduring The Month Of September Omet Is Showcasing Quite Contemporarily On The Global Stage All The Presses Belonging To The Xflex Line Xflex X6 And Xflex X4 Will Be On Stage At Labelexpo Americas Rosemont Illinois 912 September And Xflex X2 In Cape Town South Africa On September 18 From 1030am To 1230pmwwwpressteccozawwwometcomwwwarchipelagoometitmedia Contact At Omet Srl Massimo Bellingardi Mktometit Tel 39 0341 282661raffaella Comunetti Raffaellacomunettiometit

Flexibility Speed Amp Ease Of Use Take Center Stage At Pack Expo International 2014the Future Of Package Printing Lies In Fast Flexible And Smart Technologies Todayrsquos Manufacturers Are Striving To Meet Growing Consumer Demand For Products Tailored To The Needs And Preferences Of Different Market Segments Split By Region Gender Age And A Multitude Of Demographics As The Mass Manufacturing Of Onesizefitsall Products Gives Way To Small Diverse Batch Production Companies Must Equip Themselves With Package Printing Technologies That Maximize Flexibility Speed And Controlfor Brand Managers This Yearrsquos Pack Expo International 2014 Nov 25 2014 Mccormick Place Chicago Will Offer An Array Of New Technologies Enhancements And Educational Insights For Package Printing Labeling And Coding And Marking Colocated With Pharma Expo A New Show Coproduced By Pmmi The Association For Packaging And Processing Technologies And The International Society For Pharmaceutical Engineering Ispe The Two Shows Will Feature 2000 Exhibitors And Attract Roughly 50000 Attendeespack Expo And Pharma Expo Attendees Will Find Many Package Printing Solutions In The Brand Zone An Area Dedicated Exclusively To Brandenhancing Packaging Materials Containers Advanced Print Effects And Design Resources As Just One Of Pack Exporsquos Customercentric Features The Brand Zone Helps Attendees Maximize Their Time At The Eventsome Of The Technologies On Display Will Include Recentlylaunched Digital Capabilities That Hold The Promise Of Reducing The Time To Market For New Products Other Technologies Include New Highspeed Inkjet Equipment As Well As Inmold Labeling Options That Offer Improved Product Protection Attendees Will Also Find New Ethernet And Mobile Technologies For Remote Monitoring And Troubleshooting Of Manufacturing Lineshighspeed And Highly Flexibleone Of The Biggest Names In Laser And Continuous Inkjet Printing Technologies Domino Amjet Inc Booth S3502 Will Exhibit New Highspeed Equipment For Beverage Labelingldquomanufacturers Are Demanding Solutions For Applications Like Beverage Labeling That Require Highspeed And Flexibilityrdquo Says Bill Bonaccorsi Domino Amjetrsquos Director Of Marketing Ldquoa Company Needs The Versatility To Do A Run Of 12ounce Bottles And Then Switch To Different Bottle Sizes Using The Same Line Through Our Product Evolution We Are Able To Do Print Runs At Twice The Speed Of Earlier Technologiesrdquobonaccorsi Adds That The Companyrsquos Recent Market Additions Have Come With A More Intuitive Common Interface That Simplifies Use And Reduces Training Timesdomino Amjet Recently Introduced The A520i Continuous Inkjet Printer Which Offers High Speeds And A 316stainless Steel Outer Casing The Casing Is Designed For Harsh Production Environments And Washdowns For Various Food Beverage And Dairy Applications It Also Has Ip66 Protection For Dust And Water The Company Also Plans To Feature At Its Booth The New Dseries Laser Itech 15 Scanhead Which Bonaccorsi Says Has The Largest Laser Print Area On The Market Also On Exhibit Will Be The V230i Thermal Transfer Overprinter Which Requires No Plant Air And Is Designed For Lower Cost Of Ownershipa Digital Revolutionhewlettpackard Booth S4271 Will Demonstrate Some Of The New Technologies From Its Digital Printing Portfolio Including Indigo And Scitex Presses For Labels Shrink Sleeves And Flexible Packaging Applications The Technologies Are Also Suited To Corrugated Retailready Packaging Hp Recently Launched Its Indigo 20000 Digital Press For Continuousfed Packaging Applications And Indigo 30000 Digital Press For Sheetfed Packaging Applications Which Accommodate 30inch Wide Film Rolls With Up To 44inch Repeat Lengthaccording To Simon Lewis Director Of Strategic Marketing For Hprsquos Indigo Division The New Presses Represent An Ldquoindustrial Revolutionrdquo For The Package Printing Industryldquothis Brings Digital Printing Into Areas That Were Previously Analog And With This Comes Benefits Such As Reducing Waste To Nearly Zero And Speeding Timetomarketrdquo He Says Ldquomarketing Campaigns Can Be Far More Nimble And They Can Include Regional Variations It Moves Us From Mass Production To Mass Customizationrdquohprsquos Scitex Fb10000 Industrial Press Uses A Proprietary High Dynamic Range Hdr Print Technology Which According To The Company Provides The Quality And Speed Required By Traditional Offset Applicationsnbspwith Digital Efficiencyldquoretailready Packaging Versioning Due To Sku Proliferation And Localization And Shortened Campaign Durations Pose Significant Challenges For Traditional Printrdquo Says Ken Vanhorn Category Manager For Hp Scitex Ldquodigital Print Technology With Minimal Makeready Time Substrate Versatility And High Quality Makes It Possible To Not Only Produce Profitable Short Runs And Sameday Prototyping But Also Frees Up Capacity For Longer Runs More Suitable For Traditional Printing Pressesrdquocustomized Integrationalso At The Show Labelpack Automation Booth E8862 Will Be Showcasing Its Integrated Services For Package Printing As Well As A New Electric Printandapply Tamp Label Applicator According To Robert Marasco Vice President Of Sales The New Applicator Can Be Used For Sensitive Applications With No Air Pressure He Says Most Printing Systems Require 80psi Of Air Or More For Labelinglabelpack Automation Designs And Builds Equipment For Labeling Almost Any Product And It Works Closely With Manufacturers Of Print Engines Scanners Hot Stamp Coders Ink Jets Case Erectors And Sealers To Customize Solutions According To Marasco Part Of The Companyrsquos Customization Includes Wide Use Of Digital Printing Capabilitiesldquowersquore Working With Customers And Our Partners To Develop Printing Solutions That Run At Four To Five Times The Speed Of Standard Digital Printing Which Allows Our Customers To Be More Competitiverdquo Marasco Says Ldquothese Digital Systems Require No Plate Changes And Everything Can Be Done Lsquoon The Flyrsquo From The Copy To Barcodes To Variable Imprintingrdquoremote Controlpackage Printing And Labeling Operations That Can Be Remotely Monitored Enable Faster Troubleshooting Giving Users 247 Access To Operations From A Smart Phone Tablet Or Pc Offering The Potential For Greater Control To Help Lines Run More Efficiently Diagraph An Itw Company Booth S3304 Is Offering The New Linx 7900 Continuous Inkjet Cij Printer With Linx Insightreg Remote Web Control Software The Software Allows Users To Monitor Production Lines Remotely And Make Commands To Connected Printers Diagraph Manufactures And Distributes Ink Jet Coders Laser Coders And Automated Labeling Systems To A Number Of Markets Including Food And Beverage Household Goods Personal Care And Wire And Cableldquocustomers Are Demanding Ease Of Use And Connectivity In Addition To Best In Class Productsrdquo Says Chris Pangallo Product Manager Cij And Laser Products For Diagraph Ldquolinx Insight Software Helps Manufacturers Take More Control Of Production Lines The Software Allows You To Download Or Upload Messages From A Pc To The Linx 7900 And Even Monitor It From Your Smart Phonerdquodiagraphrsquos Allelectric Printer Applicators Offer Multiple Solutions With Just One System According To Steve Dods Product Manager For Alp And Tto Product Lines Diagraphrsquos Efasa Swing Arm Solution Is Capable Of Either Applying Two Labels On Two Adjacent Panels Or A Single Wraparound Label To A Front And Side Panel Customers Can Switch Between Either Method At Any Time And The Switch Is Easily Made Through The User Interfacediagraph Also Has Solutions For Manufacturers Who Are Trying To Find More Ways To Improve Sustainability Efforts And Reduce Material Useldquomany Customers Are Now Operating Tray Packs With Just A Single Corrugate Sheet On The Bottom Which Means Traditional Inkjet And Tamp Application Methods Are No Longer Viable Optionsrdquo Dods Says Ldquoto Address This New Packaging Our High Speed Tamp Hst Options Allow Complete Label Adherence To Contoured Substratesrdquoinmold Labeling Innovationnypro Booth N5775 Customizes Differentiated Plastics Packaging From Conceptualization To Design For Leading Consumer Product Brands Joe Stodola Nyprorsquos Vice President For Business Development Says Many Consumer Brands Are Movingnbspaway From Round And Tonbspdifferentlyshaped Packages That Utilize Inmold Labeling Imlnbspand Somenbspwith Special Barrier Protections Dairy Is One Example He Notes Where Therersquos A Move Tonbspnonround Iml Packagingnyprorsquosnbspradius Andnbspinternalnbspdevelopment Groups Have Worked With Brand Managers To Engineer Packaging And Stodola Says That A Number Of Brand Owners Are Leveraging Decorative Iml Capabilities With Highend Graphics To Help Brands Stand Out On The Store Shelfnypro Is Developing Another Type Of Packagingnbspthat Uses Coinjection Molding Technology To Incorporate An Evohbarrier Packagenbspto Protect The Food Or Beverage While On Shelfldquothis Will Extend The Freshness Of Food Products Without A Secondary Bag Seal And It Works Better Than Standard Propylenerdquo Stodola Says Ldquobarrier Packaging Is Nothing New Whether Itrsquos Glass Or Tin But This Is The First Time Wersquore Able To Create Barrier Packaging In A Highvolume In A Thinwalled Injection Molded Formatrdquofor Label And Flexible Packaging Company Precision Press Booth N6169 Laminated Iml Labels Offer Unique Benefits Of Barrier Properties Scratchresistance And Fda Compliance For Food Contact According To Tim Goserud Director Sales And Marketing For The Companyrsquos Packaging Division There Is A Growing Need For Iml Solutions Developed With Unique Materials That Offer Specific Barrier Propertiesprecision Pressrsquo Web Offset Print Process Combined With The Most Precise Die Cutting Technology In The Industry Gives Them A Distinct Advantage Producing Laminated Iml Labels With Functional Capabilities Vs The More Common Iml Sheet Ndashfed Only Printersldquoour Lamination Capabilities Give Us More Options For Creating Labels That Have Uv Oxygen And Moisturebarrier Properties Along With Abrasion Resistance Besides Protecting From Many Migration Scenarios We Can Add High Definition Decoration To These Labelsrdquo Says Goserudat The Show Precision Press Will Be Discussing New Inhouse Molding Prototyping Technologies Goserud Says These New Capabilities Will Offer Proof Of Concept With Minimal Investment Helping Brand Managers Get New Iml Packaging To Market More Quicklynew Serialization And Adhesives Technologyfor The Global Pharmaceutical Industry Serialization Will Continue To Be A Major Line Upgrade Challenge For The Coming Years Weiler Labeling Systems Booth S4172 Has Developed Two Solutions For The Highspeed Printing Of Serialized Codes On Labels Prior To Application Including The Sps200 Print Stand For Existing Labeling Equipment And The New X4s Labeling Head For New Wls Labelers Weiler Specializes In Pressuresensitive Labeling With The Majority Of Its Business Coming From The Pharmaceutical Market And The Remainder Coming From The Consumer Products Food And Beverage Marketsat The Show Wls Will Be Introducing The New Rl840n Rotary Labeler Which Utilizes Patented Activatable Adhesive Technology Developed By Nulabel Technologies This Labeler Applies Cutandstack Labels That Have A Dry Adhesive Precoated Onto The Label The Labels Are Activated By A Clean Waterbased Gluefree Spray Just Prior To Applicationldquothis Is Done Using Our Continuousmotion Rotary Platforms And The Technology Eliminates The Use Of Cold Glue And The Associated Problems Typically Seen With Cut And Stack Labelersrdquo Says Philippe Maraval Vice President Of Sales And Marketing Ldquoit Minimizes The Need For Cleaning And Reduces Downtime We Feel That This Technology Will Transform The Cutandstack Labeling Approach In The Future As Users Experience Higher Overall Equipment Effectivenessrdquoto Register For Pack Expo International 2014 Visit Packexpocom Registration Is 30 Prior To Oct 3 2014 And 60 Thereafterabout Pmmipmmi The Association For Packaging And Processing Technologies Is A Trade Association Representing Over 650 Packaging And Processing Supply Chain Companies That Provide A Full Range Of Packaging And Processing Machinery Materials Components And Containers Pmmi Actively Brings Buyers And Sellers Together Through Programs And Events Such As The Pack Expo Family Of Trade Shows Packexpocom Pmt Magazine Pack Expo Show Daily Networking Events And Educational Programspmmi Organizes The Pack Expo Trade Shows Pack Expo International Pharma Expo Colocated With Pack Expo International And Presented Jointly With The International Society For Pharmaceutical Engineering Ispe Pack Expo Las Vegas Pack Expo East Expo Pack Meacutexico And Expo Pack Guadalajara Connecting Participants In The Packaging And Processing Supply Chain With Their Customers Around The World Coming Up Expo Pack Meacutexico 2014 June 17ndash20 Mexico City Mexico Pack Expo International 2014 Nov 2ndash5 Mccormick Place Chicago Pharma Expo Colocated With Pack Expo International 2014 Pack Expo East Debuting Feb 16ndash18 2015 Pennsylvania Convention Center Philadelphia Expo Pack Guadalajara 2015 March 10ndash12 2015 Guadalajara Jalisco Mexicolearn More About Pmmi And The Pack Expo Trade Shows Atnbsppmmiorgnbspandnbsppackexpocomnbspcompany Urlsdomino Amjet Wwwdominoprintingcomhewlettpackard Wwwhpcomlabelpack Automation Wwwlpautomationcomdiagraph Wwwdiagraphcomnypro Wwwnyprocomprecision Press Wwwprecisionpressinccomweiler Labeling Systems Wwwweilerlscom

2014 Indonesia Corrugated Industry Summit Organized By Reed Exhibitions And Coorganized By The Indonesian Corrugated Cardboard Industries Association Picci Will Be Held On Sep 22th24th 2014 At Pullman Jakarta Central Park Hotel Since The Foundation Of Sinocorrugated In 2001 The Indonesian Corrugated Cardboard Industries Association Picci Has Been In Support Of Sinocorrugated For 10 Years This Summit Will Blow The Horn Of The Global Expansion Of Sinocorrugatedintroduction Of The Indonesian Corrugated Cardboard Industries Association Picciindonesian Corrugated Cardboard Industries Association Picci Is The Official Association Of Carton Box And Corrugated Cardboard Manufacturers In Indonesiasince The Establishment Of This Association In 1973 Picci Has Been Committed To A Twofold Mission Firstly It Is Piccirsquos Aim To Unite Carton Box Manufacturers And The Supporting Industries In Indonesia By Encouraging The Sharing Of Information And Greater Mutual Understanding Among Association Members Secondly Picci Is Committed To Enhance Our Business Environment Through Healthy Competitionand The Vision Today At Picci Is To Inspire All The Members To Become Professional Players In Our Industry While At The Same Time Preparing Them To Compete On An Equal Footing With Global Playersall Members Of Picci Are Manufacturing Companies Of Carton Boxes Ranging From Smallscale Producers With Only One Corrugation Machine To Large Manufacturers With Stateoftheart Manufacturing Facilities The Members Serve A Variety Of Customers Both Within Indonesia As Well As Overseas In Several Business Sectors Including Consumer Goods Electronics And Pharmaceuticals Every Corrugated Carton Box Manufactured By A Picci Member Is Tailormade To Meet Each Individual Customerrsquos Specificationassociate Picci Members Include The Essential Supporting Industries Including Suppliers Of Ink Glue And Machinery As Well As Paper Manufacturersthe Main Purpose At Picci Is To Maintain Industry Standards And Ensure That All Our Members Refrain From Any Conduct That Could Impede Their Operations Or Development At The Same Time Picci Is Committed To Encouraging Greater Cooperation As Well As Mutual Responsibility Between Picci Members In Order To Produce Higher Quality Productspicci Believes This Can Be Achieved By Focusing On Three Specific Areas Firstly By Increasing And Developing Picci Membersrsquo Expertise Through Training And Seminars Secondly Through Sharing Information Among Picci Members As Well As Providing Consultation When And Where Necessary And Thirdly To Ensure Continued Ongoing Improvements In The Production Process Of Picci Members To Achieve A Higher Level Of Efficiencyin Terms Of Shortterm Objectives Picci Is Dedicated To Ensure That The Association Members Remain Manufacturers Of High Quality Carton Boxes With Added Value In Addition Picci Is Also Dedicated To Providing The Best Benefits To All Picci Members In Terms Of Our Dealing On Membersrsquo Behalf With Third Parties Such As Conference And Exhibition Organizers Customers And Suppliers As Well As Technical And Government Institutions 2014 Indonesia Corrugated Industry Summit Reveals The Motive Powers Of The Indonesian Corrugated Cardboard Industries Association Piccifor Full Version Please Click Httpsinocorrugatedcomennewsinfonewsincorrsummitsupportpicci828

Polysack Flexible Packaging Ltdnbspreceived Formal Recognition In June 2014 From Thenbspassociation Of Postconsumer Plastic Recyclers Aprnbspin North America For Developingnbsppolyphanetrade Fitnbspfilm That Meetsnbspaprrsquos Stringent Testing And Guidance Criteria For Sleeve Label Ink And Substrate For Pet Bottlesnbsppolysacknbspis A Developer And Manufacturer Of Innovativenbspmdobased Packaging Films For The Beverage Food And Confectionery Industriesnbspaprnbspannouncednbsppolysackrsquosnbspfull Compliance With The Guidelines Ofnbspaprrsquosnbspcritical And Applications Guidance Recognition Program Designed To Help Packaging Developers Conform To Recycling Rulesnbspaprnbspcongratulatednbsppolysacknbspfor Its Success In Developing Innovative Packaging And Thankednbsppolysacknbspfor Its Cooperation In Usingnbspaprrsquosnbspprotocolnbspaprnbspexpressed Its Belief Thatnbsppolysackrsquosnbspnew Technology Will Benefit Worldwide Recycling Efforts By Reducing The Negative Impact That Sleeve Labels Have On Pet Recycling Todaynbsppolyphane Fitnbspis A Highshrink Polyolefinbased Film Used For Producing Rollfed Wraparound Shrink Labels For Beverage Bottles The Lightestweight Recyclable Mdfilm In The Worldnbsppolyphanetradenbspfitnbspyields Shrink Ratios From 35 To 65 Generating Close To 0 Scrap Thereby Reducing Manufacturing And Material Costs By 30 Compared To Conventional Sleevesnbspduring The Labelling Process The Film Runs On The Conveyer Belt In The Same Direction As The Bottles And The Sleeves Are Produced Simultaneously Increasing Labelling Speed While Eliminating Several Inspection Steps And The Need To Produce Actual Sleevespolyphanetrade Fitnbsplabelling Film Contains A Nonhalogen Material Which In A Series Ofnbspaprnbsptests Enabled Easy Separation And Floatation Of Labels During The Recycling Process With No Ink Dissolution John Standishnbspaprrsquosnbsptechnical Director Said Thatnbsppolysacknbsphad Taken Ldquoa Huge Step In Helping Generate More Good Clean Material Available For Recyclingldquo The Announcement Followsnbsppolysackrsquos Longstanding Commitment To The Environment Working Closely With Customers And Recycling Agencies To Consistently Manufacture Ecofriendly Solutionsnbspnbspnbspfor Further Information Please Visitnbspwwwpolysackcomnbspor Contactnbspsalespolysackcomnbsp

Selig Grouprsquos Forrest Il Closure Seal Manufacturing Facility Has Recently Received The Highest Level Certification Grade A Under The British Retail Consortiumlsquos Brc Global Standards For Packaging And Packaging Materials By Utilizing Principles From Iso Haccp And Gmp The Brc Has Become One Of The Most Highly Respected Food Safety Standards In The Worldnbsp Selig Is Believed To Be The Only Global Liner Supplier To Have Achieved This Significant Industry Recognitionnbspseligrsquos Brc Audit Was Conducted At Selig Forrest On July 2425th 2014 By One Of The Major Certification Bodies In The World Uldqs Inc By Receiving An Lsquoarsquograde Rating Selig Ndash Forrest Has Significantly Strengthened Its Food Safety Standards And Practicesnbspthe Brc Certification Is One Of Several Progams That Meet The Requirements Of The Global Food Safety Initiative Gfsinbsp The Brc Was The First Standard To Be Recognized As Meeting The Gfsi Requirementsnbsp The Gfsi Is An Internationally Recognized Food Safety Standard That Has Been Led By Several Major Food Retailers And Producers Such As Mcdonalds Cocacola Walmart Mondelz And Danonenbsp The Gfsi Charter Is Continuous Improvement Of Food Safety Management Systems To Ensure Confidence In The Delivery Of Safe Food To Consumers Worldwide Gfsi Provides A Platform For Collaboration Between Some Of The World39s Leading Food Safety Experts From Retailer Manufacturer And Food Service Companies Service Providers Associated With The Food Supply Chain Packaging Companies Other International Orgnizations Academia And Governmentnbspselig Grouprsquos Swiss And Uk Operations Have Previously Received Brc Grade A Certification In Addition Seligcanada Is Currently Preparing For Brc Certification Converting Its Food Safety Standards From The Asi Certification Programnbspabout Selig Groupselig Group Is The Worldrsquos Leading And Largest Manufacturer Of Closure Liners And Induction Sealsnbsp Selig Has Been Meeting The Needs Of The Food Amp Beverage Pharmaceutical Neutraceutical Agricultural Personal Care And Chemical Industries For Over 120 Years Four Manufacturing Locations Usa Canada Uk Switzerland And A Large Broker Network Assure Supply And Service Globallynbsp The Halfmoon Tabbed Lift 39n39 Peeltrade And Top Tabtrade Liners Are Consumer Preferred For Ease Of Removalnbsp These Products And Industry Leading Safegardtrade Foilsealtrade And Unigardtradenbsp Brand Product Families Are Trusted By Marketleading Companies On Billions Of Products A Year To Provide Freshness Safety Leak Protection And Tamper Evidencepress Contactmatthew Orsquodonnell Marketing Specialistmodonnellseligsealingcom6306157244

Roberta Ghilardi Takes Over As Interim Ceonbsproberta Ghilardi Has Been Heading Business Operations At The Darmstadtbased Mechanical Engineering Company Goebel Schneid Und Wickelsysteme Gmbh Since 1st August 2014 The Previous Ceo Dr Ralf Enderle Will Remain With The Company A New Ceo Will Lead The Company Starting In 2015nbsproberta Ghilardi Has A Degree In Engineering And Has Worked For Ims Deltamatic Group Since 2000 As Head Of Business Process Reengineering And Controlling She Is Primarily Responsible For The Integration Of New Companies Into The Italian Mechanical Engineering Group She Has Also Successfully Managed Projects To Optimise Quality And Processes Roberta Ghilardi Will Conduct Her Duties As Interim Ceo At Goebelnbspafter Obtaining His Doctorate From The Department Of Mechanical Engineering At Tu Darmstadt Dr Enderle Began His Professional Career At Maschinenfabrik Goebel Gmbh In 1985 He First Worked As An Assistant Before Becoming The Head Of The Design Department For Slitter Rewinders He Was Later Named Technical Director For The Paper And Films Business Unit In 2001 Dr Enderle Was Appointed To The Management Of The Newly Founded Goebel Schneid Und Wickelsysteme Gmbh And Became Its Ceo In 2010nbspgoebel Schneid Und Wickelsysteme Gmbh Is A Leading Provider Of Slitter Rewinders For Converting Papers Plastic Films And Special Materials The Hessian Company With A Long Tradition Has Been Constantly Setting Standards In Mechanical Engineering For Over 160 Years The Range Of Products Includes Primary And Converting Machines Such As Twodrum Winders For Paper And Cardboard Converting These Are Developed And Manufactured According To Customer Requirements At The Production Facility In Darmstadt Applying Only The Highest Standards In Terms Of Productivity Quality And Precisionnbspnbspas Of 1st July 2013 Goebel Schneid Und Wickelsysteme Gmbh Has Been A Member Of The Ims Deltamatic Group The Successful Integration Of The Darmstadtbased Traditional Company Into The Italian Group Is A Logical Step In Futureoriented Corporate Governance The Successful Merger Of These Strong Partners Has Created A Company That Is Able To Bring Together Synergies And Put Them To Optimum Use The Ims Deltamatic Group Is The International Reference Point In Engineering And Manufacturing Of Innovative Machinery In Various Industrial Sectors Such As Converting And Automotivenbsppress Contactnbspgoebel Schneid Und Wickelsysteme Gmbh Ndash Kerstin Stumpftrautmann Group Marketing Manager Ndashnbspgoebelstrasse 21 Ndash 64293 Darmstadt Ndash Phone 49 6151 8881 Kstumpfgoebeldarmstadtdenbspnbspnbspnbsp

National Association Of Business Resources Recognizes Omron Automation And Safety A Best And Brightest Elite Winnernbspnbspschaumburg Il August 14 2014 Ndash The National Association For Business Resources Nabr Recently Recognized Omron Automation And Safety Wwwomron247com As An Elite Winner For Strategic Company Performance During The Associationrsquos Annual Chicagorsquos Best And Brightest Companies To Work Forreg Luncheon In Chicago Il Elite Chicago Award Winners Are Honored In One Of 12 Different Categories For Best Practices In Human Resource Programs Winners Are Selected Based On Unbiased Quantitative Data And Statistical Analysisnbspldquothis Is The Fourth Consecutive Year In Which Omron Automation And Safety Was Recognized As One Of The 101 Best And Brightest Companies To Work For In Chicago And The Second Consecutive Year We Were Recognized As An Elite Winnerrdquo Says Nigel Blakeway Chief Executive Officer Omron Automation And Safety Ldquothis Recognition Demonstrates Our Sincere Commitment To Progressive Leadership Practices That Foster A Culture Where People Want To Work And Where Employees Can Truly Thriverdquonbspthe Elite Award For Strategic Performance Recognizes The Level To Which Human Resources Is Actively Engaged With The Executive Team In Setting Overall Business Strategynbspthe Best And Brightest Companies To Work Forreg Is Presented Annually In Atlanta Detroit Chicago Grand Rapids Houston Milwaukee San Francisco And Nationally More Information Is Available At Www101bestandbrightestcomnbspmedia Contacts Nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspchris Nelson 6122374443 Chrislongrenparkscommark Traxler 8472857176 Marktraxleromroncomnbspabout Omron Automation And Safetyheadquartered In Kyoto Japan Omron Corporation Is A Multibilliondollar Diversified Company With Business Units Producing Industrial Automation Products Electronic Components Healthcare Equipment And Ticketing Systems Omron Automation And Safety Is A Global Leader Providing Complete Automation Solutions For Industrial Applications The Panamerican Headquarters Is Located In Hoffman Estates Illinois Usain Usa Tel 86688omron Email Omroninfoomroncomin Canada Tel 86698omron Email Askomronomroncomin Mexico Tel 81 1156 9910 Emailnbsp Melaomroncominternet Wwwomron247comnbspabout The Best And Brightest Programsthe Best And Brightest Companies To Work Fortrade Is A Program Of The National Association For Business Resources That Provides The Business Community With The Opportunity To Gain Recognition Showcase Their Best Practices And Demonstrate Why They Are An Ideal Place For Employees To Work This National Program Celebrates Those Companies That Are Making Better Business Creating Richer Lives And Building A Stronger Community As A Whole There Are Numerous Regional Celebrations Throughout The Countryinternet Www101bestandbrightestcom

Loeschpack Unveils Innovative Packagingsolutions For The Confectionery Industrygt Packaging Chocolate Chewing Gum And Confectionerygt Global Optimization Of Service Quality And Customer Supportnbspaltendorfbamberg August 11 2014 Ndash From November 2 To 5 2014 Loesch Verpackungstechnik Gmbh In Altendorf Franconia Will Be Headlining Its Claim To Global Leadership In The Packaging Machinery Market On The Confectionery Pavilion At The Pack Expo 2014 In Chicagoin South Hall Stand 2393 The Systems Provider Will Be Unveiling Innovative And Leadingedge Complete Solutions For The Confectionery Industry Loeschpack Continues To Set Standards At One Of The Worldrsquos Leading Trade Fair For The Industry With Its Refined Customercentric Service Solutions The Centrepiece Of This Development Is The Technical Centre Inaugurated Directly Adjacent To The Production Facilities In 2014 Where Existing And Prospective Customers Can Test Packaging Machines And Train Their Staff Ldquowe Create Samples And Carry Out Test Runs With Original Materials Ndash Also In Customized Formats The Generated Data Is Used To Analyse The Costeffectiveness And Feasibility Of Our Customersrsquo Highly Specific Projectsrdquo Says Andreas Graf Managing Director Of Loeschpack Ldquoworking Together With Our Customers Thus Intensifies Our Corporate Philosophy Of Lsquogt Packaging Your Ideas Rsquordquonbspgt Packaging Chocolate Premium Presentation Of Chocolate Bars In Cardboardto Ensure Success At The Pos Point Of Sale Chocolate Manufacturers Present Their Bar Products In Premium Cardboard Packaging Tightly Sealed Flow Packs For The Primary Wrap Guarantee Excellent Protection For The Products A Flow Pack In Cardboard Is An Ideal Choice For An Efficient And Inexpensive Solutionon Stand 2393 In South Hall Loeschpack Will Jointly Be Presenting The Fold Wrapping Machine Ltmk For Packing Prepackaged Chocolate Bars Already Flow Packed In Cardboard The Ltmk Is Mechanically Designed For An Output Of Up To 220 Bars Per Minutenbspat The Pack Expo Loeschpack Is Unveiling A Version Of The Machine Which Packs 170 Bars Per Minute Depending On The Design Of The Flow Packs Outputs Of Up To 200 Barsminutes Can Be Achieved With The Machine The Cardboard Is Processed From A Flat Precut Blank The Bottom Seam Is Sealed Using Hotsetting Glue The Side Tabs Are Tucked In And Also Optionally Sealed As A Temperevident Seal Cardboard Boxes Of Varying Quality Can Be Processed The Machine Features A Large Format Range For Rapid Flexible Changeoverin Contrast To The Horizontal Cartoning Machine Typical Bar Shapes And Tapers Can Also Be Accurately Reproduced This Enables Economic Cartoning The Production Of Innovative Pack Styles And A Premium Presentation Of The Chocolate Bars At The Posnbspgt Packaging Chewing Gum Amp Confectionerygum Information Center At Packexpo 2014 Loeschpack Will Be Completing Its Display With A Wideranging Presentation On All Aspects Of The Subject Of Chewing Gum Technical Animations Videos And A Multitude Of Fascinating Product Samples Will Be Shownfind Out About The Automation Solutions For Example The Brand New Loesch Sheet Breaker Lsb For Feeding Chewing Gum Slabs Into Highperformance Packing Machines Our Twinlane Highperformance Fold Wrapping Machine For Tabgum Our Expert Team On The Stand Will Be Happy To Explain The Details Of Our New Gw06 Highperformance Machine To Prospective Customers As The Heart Of Modern Chewing Gum Packaging Lines The Machine Can Be Equipped With A Range Of Addon Modules For Different Tasks We Will Also Be Delighted To Tell You About Our Innovative Chewing Gum Packaging Using Production Line Concepts With Components For Wrapping Boxing And Sealing Multipacks In Cellophanenbspabout Loesch Verpackungstechnikloesch Verpackungstechnik Gmbh Is An International Manufacturer Of Packaging Machinery And Systems Based In The Bavarian Town In Altendorf As A Subsidiary Of The Piepenbrock Group The Company Offers Integrated Solutions For Customerspecific Packaging Systems At The Same Time Loeschpack Offers The Entire Spectrum Ndash From Semiautomated Or Simplyautomated Entrylevel Solutions To Multilevel Complex System Solutions The Companyrsquos Product Range Includes Packaging Machines For The Food And Nonfood Sectors Loeschpack Is Particularly Specialised In The Packaging Of Chewing Gum Chocolates And Dry Baked Goods Loeschpackrsquos Cuttingedge Production Methods And Comprehensive Quality Management Are The Foundation On Which Its Sophisticated Hightech Economical And Highquality Machinery And Equipment Are Builtnbsploeschpack Cares With High Responsibility About The Environment We Offer Customers Carbonneutral Machines With The Ldquocarbon Neutral Packagingrdquo Label Any Emissions Released During The Value Creation Process Are Offset Through Climate Protection Projects Ndash And Confirmed By A Certificate Issued By A Neutral Third Party In Addition Loeschpack Plants Trees In Piepenbrockrsquos Rheinshagen Forest Ensuring Carbonneutral Operation Of Its Machines At Customer Sitesproduct Portfoliogt Feeding Systemsgt Robotic Pick And Place Systemsgt Trayloading Systemsgt Roll And Stick Wrapping Machinesgt Fold Wrapping Machinesgt Carton Erecting And Filling Machinesgt System Solutions Tailored To Applicationsgt Complete Packaging Linesnbspdiscover More About Loeschpack Athttpwwwloeschpackcom

How Ecover Came To Make Use Of Plastic Waste From The Sea To Create Bottles Provides Valuable Lessons And Ideas To All Product Packaging Leadersnbspa Worldfirst In Packaging A New Form Of Recyclable Plastic That Incorporates Sea Plastic Postconsumer Recyclables And Plantbased Plastic Came About When Tom Domen Long Term Innovation Manager At Ecover Was Looking For A Packaging Solution That Could Make A Long Term Positive Contribution To The Environmentldquomy Goal Was Not To Simply Create Packaging That Used Less Material Or That Had A Slightly Less Negative Impact On The Environment We Wanted A Solution That Was Potentially Able To Be Restorative And Take Something Bad Out Of The Environmentrdquo Said Domen A Speaker At Thenbspmarcus Evansnbspeuropack Summit 2014 Taking Place In Cascais Portugal 8 9 September With Water Quality A Big Concern Globally Ecover Decided To Make Plastic Floating In The Ocean Ldquopart Of The Solution Rather Than The Problemrdquonbspnbspas For The Financial Feasibility Of Using This Material Domen Explained That Although It Costs More Today Scaling Up Will Make It More Affordable In The Future Ldquowe Are In The First Trial Phase Trying To Get More Fishermen In The Network We Do Not Have A Lot Of Material Coming In And What We Do Get Is From Different Places They Must All Be Brought Together And Transported To Recyclers Who Need To Do A Special Run Just For Us All These Processes In The Supply Chain Are On A Small Scale But We Hope That Scaling Up Will Make It More Feasiblerdquo New Subsidies For Fishermen In Europe Will Help Bring Down Some Of The Costs But Getting More Material Coming In And Working More Efficiently With Fishermen And Recyclers Are All Part Of Domenrsquos Planwhile The Core Proposition Of The Ecover Brand Has A Strong Focus On Sustainability It Does Not Mean That Other Companies Cannot Find A Value In Ocean Waste Ldquoas A Company We Still Need To Make A Profit And We Can Recover The Additional Costs Through The Marketing Benefits It Will Bring About That Is How Other Organisations Can Realise Value Even If They Are Not As Focused On Sustainability As We Are They Can Consider The Investment Into The Material As A Marketing Investment To Tell A Marketing Story To Consumers To Show They Are Serious About Their Corporate Social Responsibilitiesrdquogetting The Plastic Out Of The Ocean Efficiently Has Been One Of Ecoverrsquos Biggest Challenges So Far Ldquofishermen Did Not Create This Waste Problem So Convincing Them To Work With Us Has Been Difficult We Had To Do A Lot Of Engagement With The Community To Explain What We Are All Aboutrdquo Domen Notedldquocompanies Can Engage The Community In Multiple Ways By Organising Beach Cleanups And Looking For Other Ways To Get The Plastic To The Recycler Any Efficiency That Can Be Gained Would Be Goodrdquo Another Issue Is The Quality Of The Plastic Recovered And Deterioration Cause By The Sun Salt And Water There Must Be A Strict Selection Process In Place In Order To Avoid Putting Low Quality Plastic Into The Recycling Chainthe Message From Domen Is Clear There Are Many Ways Of Making Packaging More Sustainable Ldquoyou Can Reduce The Amount Of Plastic Used Put More Recycled Content Look For Different Materials Connect More Efficiently With The Recycling People And So On It Is A Lot Of Hard Work To Bring That Message To Consumers That Is Why I Suggest Companies Start With One Pioneering Project To Show Consumers They Are Serious About It They Can Launch A Limited Edition Bottle That Allows Them To Tell A Packaging Story And To Engage Their Consumers On The Complex Matter Of Sustainable Packagingrdquo

West Berlin Nj August 21 2014 Ndash Thwingalbert Instrument Company Has Released A New Tensile Testing Machine Design The Vantagenxnbsp This Revamps The Popular Eja Vantage Series To Introduce A New Ergonomic Framenbsp The New Vantagenx Is Available In Capacities Of 1kn And 2kn And Will Replace The Previous Frame For Those Capacitiesnbspnbspthree Travel Distances From 24rdquo To 48rdquo Are Available To Meet Different Materials Testing Needsnbsp The Customer Has The Option To Choose Between Two Different Methods Of Operation Map4 Software Which Requires A Windows Based Pc Or The Recently Introduced Standalone Option A Bluetooth Connected Touch Screen Tabletthe Vantagenx Maintains The Flexibility Of A Universal Frame By Allowing The Testing Machine To Be Configured For Many Different Standards Using Different Grips And Fixturesnbsp This New Universal Testing Machine From Thwingalbert Can Be Used To Measure Tensile Compression Flexural Strength And Peel Strength Along With Many Other Tests To Meet Common Industry Standards Including Astm Iso Tappi And Othersnbspthwingalbert Is Excited To Introduce The Revamped Style To Customers The Vantagenx Is Designed To Keep Materials Testing Laboratories Looking Sharp While Maintaining Efficiency And Qualitynbsp This New Testing Frame Is A Prime Example Of The Companyrsquos Ongoing Commitment To Customer Satisfaction By Staying Ahead Of The Curve And Providing Options To Improve Productivitynbspplease Contact Our Office If You Are Interested In More Details About The Vantagenx At Salesthwingalbertcom Or 8567671000nbspabout The Thwingalbert Instrument Companythe Thwingalbert Instrument Company Is One Of The Nation39s Leading Manufacturers Of Advanced Testing Instrumentation For More Than A Century Thwingalbert Has Provided Proven Testing Equipment And Has Earned A Reputation As A Foremost Authority On Physical Testing Standards From The Tab On A Cough Tablet To The Seal On A Bag Of Potato Chips To The Fabric Of A Pair Of Jeans Thwingalbert Designs And Develops Products That Test The Physical Properties Of A Wide Range Of Materials Research Laboratories And Quality Control Departments Worldwide Confidently Rely On Thwingalbert39s Affordable Precision Instruments To Develop And Produce High Quality Productsnbsp

Due To Rising Demand For Fastmoving Consumer Goods And Other Household Items Indonesian Investment In Corrugators Continues To Increase In The Past Year Indonesiarsquos Production Capacity Of Corrugated Paperboard Rose 12 And The Countryrsquos Total Annual Corrugated Industry Production Capacity Reached 5 Million Tons 2013 Was The Fourth Consecutive Year Of Doubledigit Growth For The Industryrsquos Production Capacity In Indonesialdquotoday There Are About 160 To 170 Corrugators Of Different Widths In Use In Indonesiardquo Said Kinardo Ang President Of The Indonesian Corrugated Cardboard Industries Association Picci And General Manager Of Pt Satyamitra Kemas Lestari Skl A Corrugated Board Manufacturing Company Ldquomost Recently Invested Corrugators Are Between 22 And 25 Meters In Width With Speeds Of 200mmin Or Higher That Includes The Mitsubishi And Isowa Corrugators As Well As Five More From The Chinese Mainlandrdquo About 60 Of Indonesiarsquos Corrugators Are In The Greater Jakarta Area In West Java 25 Are Installed In East Java 5 In Central Java And The Rest In Medan North Sumatra Palembang South Sumatra And Batam Near Singaporemost Corrugators In Indonesia Use Lightweight Paper The 125g Corrugated Paper That Was Formerly Standard Use Is Now Being Phased Out In Favor Of 112g Paper At The Same Time 200g Cardboard Has Been Reduced To 150 Grams Most Of The Resultant Paper Is Made From Locally Sourced Raw Materials Although Indonesia Has An Annual Production Capacity Of 5 Million Tons Corrugators Are Only Being Used To 60 To 70 Of Their Capacity Nevertheless Investments Are Still Being Injected Into Carton Plants And Corrugators In Indonesiaapart From Investing In New Corrugators Many Corrugated Box Manufacturers Have Invested In Postprint Production Lines Over The Past Few Years The Rise In Minimum Wage Has Forced More And More Corrugated Box Manufacturers To Upgrade And Automate Machinery Which In Turn Has Led To Greater Investment In Postprint Production Lines And Converting Equipment The Most Illustrative Example Of This Shift Is Of Corrugated Box Manufacturers Who Used To Engage 10 To 12 Laborers Along The Assembly Line As Levels Of Automation Have Increased So That Figure Has Dwindled To Just One Or Twocardboard Production Plants And Mainstream Corrugated Box Plants Pay Close Attention To Energy Costs And Look To Invest In Machines With Lower Energy Consumption Picci Has About 90 Members Who Are Corrugated Board And Corrugated Box Manufacturing Companies There Are Still About 500 Smaller Indonesian Cardboard Plants That Also Make Corrugated Boxes But Are Not Members Of The Associationin Indonesia Most Corrugated Packaging Is Used To Package Food Beverages Electrical Appliances And Electronics The Industry Is Very Optimistic About The Future Of The Rapidly Developing Indonesian Corrugated Board And Carton Manufacturing Industry The Belief Is That A New Round Of Sustained Growth Of The Corrugated Box Market Is On The Horizonthe 2014 Indonesia Corrugated Industry Summit Will Be Held At The Pullman Jakarta Central Park Hotel From September 22 To 24 This Summit Is Jointly Organized By Reed Exhibitions Organizer Of Sinocorrugated Events And The Picci As Part Of The Global Rollout Of Sinocorrugated The Summit Is Expected To Help Usher In A New Chapter In The Development Of Indonesiarsquos Corrugated Box Industryfor Full Version Please Click Httpsinocorrugatedcomennewsinfoindustrynewsaccuratedataandaccessiblelanguagedemystifying818

The New Style 500ml Bottle Now Embossed With The Thatchers Name Across The Shoulder And Featuring A Slimmer Neck Represents An 18 Per Cent Saving In Weight The Bottle Has Been Designed And Produced By Ardagh Group Who Have Supplied Thatchers For Fifteen Yearswhen Thatchers Last Redesigned Its Glass Bottle A 21 Per Cent Saving In Weight Was Then Achieved The Somerset Cidermaker Will Now Begin To Move All Its 500ml Bottled Ciders Into The New Packagingthatchers Has Also Redesigned The Label For The 2013 Vintage Cider The Gold And Black Label Which Features A Picture Of Thatchers Founder William John Thatcher Has Been Enhanced With Red For Increased Shelf Stand Out And Features The 2013 International Brewing Awards Champion Cider Medalageing In Oak Vats Which Have Been Standing For Over A Hundred Years Gives The New 2013 Thatchers Vintage Cider A Unique Character That Reflects Thatchers Handson Approach To Cider Making Nbspfourth Generation Cider Maker Martin Thatcher Saysnbspldquothe Lightweighting Of Our Bottles Is Part Of A Sustainability Programme Throughout The Company Which Includes Projects Such As The Creation Of Our Own Energy From Biomass To The Installation Of Our Own Water Borehole Creating Lighter Bottles Makes Sense Ndash Not Only Are There Savings In Energy During Production But We Estimate That Our Full Delivery Loads Will Be 17 Tonnes Lighterrdquo

One Of The Worldrsquos Most Renowned Trade Organizations The International Corrugated Case Association Icca Formed In 1961 Recently Announced That The 2015 Iccawco World Containerboard Organization Global Summit Will Be Held From April 13 Ndash 17 2015 As Well As Its First Stop In Taipei The Summit Tour Will Also Make A Stop In Shanghai To Be Collocated With Sinocorrugated 2015 The Largest Business Platform For The Global Corrugated Manufacturing Industrythe First Ever Edition Of This Corrugated Show In Which 171 Exhibitors Took Part Was Held In 2001 This Number Has Since Skyrocketed Attracting Over Three Times That Number When It Welcomed More Than 600 Exhibitors To Its 2013 Edition As A Result Of Its Global Participants And The Large Numbers Of International Stakeholders It Has Become The Highest Profile Corrugated Industry Event And An Accurate Marker Of Developmentduring The Iccawco Global Summit Business Leaders From Top Global Corrugated And Containerboard Companies Like Ds Smith Smurfit Kappa Rocktenn And International Paper Etc Will Convene In Taipei To Participate In What Is Set To Be The Most Significant Event For Years To Come Subsequent To That Together With Other Globally Leading Industry Associations Like The Association Of Independent Corrugated Converters Aicc The Asociacioacuten De Corrugadores Del Caribe Centro Y Sur Ameacuterica Acccsa The European Corrugated Packaging Association Fefco And The Fibre Box Association Fba They Will Fly To Shanghai To Join Sinocorrugated 2015the Wide Array Of Summit Topics Will Cover The Outlook Of Global Containerboard Demand Drivers For A Global Economic Recovery Innovations In Corrugated Manufacturing Captivating Displays And A Fresh Look Inside The Chinese Economy Furthermore During Their Stay In Shanghai A City Tour Chung Loong Paper Holdings Limited Factory Tour And A Gala Event Will Be Held To Celebrate The Largest Ever Gathering Of World Class Business Leaders At Sinocorrugated 2015the Icca Forecasts That Annual Growth In Chinarsquos Corrugated Industry Will Hover Around 7 From 2014 To 2016 And Corrugated Production Volumes Are Estimated To Reach 641 Million Sqm In 2015 China Is Now The Largest Corrugated Region Thanks To The Countryrsquos Sheer Scale And Highgrowth Rates That Make It A Significant Contributor To The Worldrsquos Corrugated Industry Growth The Strategic Partnership Between Sinocorrugated 2015 And The Icca Will Further Enhance The Showrsquos Value By Bringing International Standard Business Leaders Together The Show Will Be A Unique Platform Via Which To Expand Your Share Of The World39s Fastest Growing Market It Will Also Offer The Best Return On Participantsrsquo Marketing Investmentfor Full Version Please Click Httpsinocorrugatedcomennewsinfonewsinternationalcorrugatedcaseassociationtoincludesinocorrugated2015visitinglobalsummit811