Nbsppackagingconnectionscom Ndash Packaging Tech Centrallog On To Packagingconnectionscom For The Latest Tech In Packaging Printing And Labellingnew Delhi 7th January 2013 Packagingconnectionscom The Ultimate Packaging Website Features The Latest Technology In Packaging From Across The Globe The Premier Packaging Resource Can Be Used To Scout For The Most Cutting Edge Tech In This Industry The Portal Also Serves As A Great Resource For Identifying The Best Available Technology In A Certain Region The Diverse And Knowledgeable Community Of Over 90000 Members From 120 Countries Offers Visitors Supports Advice And Solutions For Unique Problems The Portal Has Over 10000 Unique Visitors Each Month The Weekly Newsletter Is A Great Way To Stay Ahead Of The Technology Curve And An Essential Tool For Professionals And Enthusiastsnbspmr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom Said Ldquopackagingconnectionscom Has Evolved Into An Essential Component Of Your Research Toolkit The Dynamic Nature Of The Portal Ensures That The Latest Innovations Technology And News Are Shared Instantly Across The Globe The Regular Contributions From Thousands Of Our Members Ensure The Freshest And Most Updated Technology News Is Available At Your Finger Tips Round The Clock Everydayrdquonbspvisit Nbsphttpwwwpackagingconnectionscom For The Latest Technologynbsp That Is Reshaping The Packaging Worldsubscribe Today To The Packagingconnectionscom Newsletter For The Latest Tech Delivered To Your Mailboxabout Packaging Connectionswwwpackagingconnectionscom Is Your Destination For Anything In Packagingwwwpackagingconnectionscom Is An End To End Solution Provider For Packaging The Skilled And Experienced Team Lead By Founder And Ceo Mr Sandeep Goyal Offers Consultation Innovation Customization And Execution In The Field Of Packaging The Company Specialize In Technical Packaging Solutions With Powerful Project Management Skills Their Exhaustive Network Of Designers Vendors And Stakeholders Allows For Best In Class Solutions For Every Budget Or Needthe Portal Is A Common Packaging Platform Connecting Packaging Professionals From All Across The Globe And The Ultimate Packaging Resource With Latest Innovations Research And Reports The Portal Also Hosts Buyer And Seller Offers Pinterviews And Offers Networking Opportunities With Key Decision Maker Buyers Sellers Users Amp Professionalsit Helps To Find Out Newer Business Opportunities In India Amp Worldwide And Promotes Direct Interaction Among Members Amp Visitorsthe Company Has Created Cutting Edge Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training With The Help Of Their Years Of Practical Industry Experiencenbspmedia Contactnbspanant Chhibbernbsptelnbsp 91 124 4965770email Anantchhibberpackagingconnectionscomnbspfor Further Details Contactamita Venkateshassociate Ndash Scientific Affairs And Consultancyamitavenkateshpackagingconnectionscomtelnbsp 91 124 4965784

Headline Ctp Flexibles South Africa Adds 3 More Titan Er610 Compact Slitter Rewinders In Recent Years Ctp Flexibles The Cape Town Based And Leading South African Converter Of Flexible Packaging Materials Has Achieved Dramatic Expansion Of Its Business In 2010 The Company Installed A New 8 Colour Fischer Amp Krecke Fp16s Flexo Printing Press And In Order To Cope With The Increased Printing Capacity It Also Installed Two Titan Er610 Compact Slitter Rewinders Ndash One 1650mm And One 1350mm Wide Machine Further Increases In Production To Serve Its Expanding Lsquoblue Chiprsquo Customer Base Led To The Addition Of Three More 1350mm Wide Titan Er610rsquos During The First Few Months Of 2012 This Brought The Total Number Of Titan Er610 Slitter Rewinders At Ctp Flexibles To Five Machines Ndash And Seven Titan Slitters In Total If Two Older Machines Are Included Ldquowe Are Enjoying Record Sales And Now Operating 247rsquo Explained Gary Seale Managing Director Of The Company Ldquowith The Five New Titan Er610 Slitters We Now Have Ample Capacity To Cope With Both Current Demand And Also Future Expansion Of Our Business Having Installed The Two Titan Slitters During 2010 We Had Every Confidence To Invest Again With Titanrdquo He Confirmed Ldquofor Our Production Requirements These Slitters Really Are The Perfect Solutionrdquo Ctp Flexibles Manufactures Specialised Plastic Extrusion And Flexible Packaging Materials Mainly For The Food Beverage And Confectionery Industries The Company Is Part Of The Ctpcaxton Group And Has Been Producing High Quality Flexible Packaging Since 1971 Ldquowe Produce Everything Hererdquo Gary Seale Added Ldquowe Extrude Highdensity Lowdensity And Linear Lowdensity Polyethylene Films And Produce Cast Polypropylene Films We Also Manufacture A Comprehensive Range Of Sophisticated Products From Laminations Multilayer Films And Shrink Films To Bags Pouches And Shrink Sleevesrdquo The Titan Er610 Compact Slitter Rewinder Has Been A Great Success With Sales Of More Than 100 Machines Worldwide It Has A Maximum Rewind Diameter Of 610 Mm 24rdquo A 10rdquo Touch Screen Control System And An Integral Edgetrim Extraction System The Pneumatically Controlled Braking System Provides Accurate Web Tension Control And A Digital Edgeguide System Controls Lateral Movement Of The Unwind Reel To 50 Mm 2rdquo The Minimum Slit Width Can Be As Narrow As 25mm Approx 1 Inch At Speeds Up To 450 Mmin 1500 Ftmin Slitting Systems Available Include Shear Knives Rotary Razor Burst Or Razor Slitting In Air Or Groove Optional Features Include An Antistatic Control System Laser Line Core Positioning And An Option For Shaftless Unwind Roll Pickup From The Floor Which Is Included On All Five Titan Er610 Slitters Commissioned At Ctp Flexibles

Reifenhaumluser Acquires Westland Corporation The Quality And Service Leader In The Us Market For Screws And Barrels The Reifenhaumluser Group Has Acquired The Us Company Westland Corporation Further Increasing The Market Share Of The Subsidiary Reiloy Metall The Reifenhaumluser Group Leading Global Manufacturer Of Plastics Processing Machinery Has Acquired The Us Company Westland Corporation Further Increasing The Market Share Of The Subsidiary Reiloy Metall The Manufacturer Of Screws And Barrels This Acquisition Will Significantly Expand The Company39s Production Capacities And Strengthen Engineering And Service In The North American Market Westland Corporation Based In Wichita Is A Us Manufacturer Of Screws And Barrels Over The Last Few Years The Company Has Taken A Leading Position In The North American Market In Terms Of Service And Quality Effective Immediately The Company Will Be Part Of The Reifenhaumluser Group Under The Name Reiloy Westland Corporation As An Independent Unit Of The Business Unit Reiloy Metall Dave Larson Formerly President Of Westland Corporation Will Continue To Manage The Business Of Reiloy Westland As President Thomas Porstner Head Of The Global Business Unit Reiloy Says Ldquoreiloy Metall And Reiloy Westland Are A Perfect Match In Germany We Have Unrivalled Expertise And Extensive Production Capacities For Producing Barrels With Inductionheated Centrifugal Casting And Are Currently The Only Manufacturer That Produces Its Own Metal Alloys Together With The Knowhow In Engineering And The Outstanding Service And Sales Network At Our New Usa Site We Now Have The Equipment And The Necessary Foundation For Growth In The North American Marketrdquo For Dave Larson President Of Reiloy Westland Joining The Reifenhaumluser Group Is The Logical Next Step For Westland After Seven Years Of Successful Cooperation Ldquowe Can Now Supply The Us Market With Larger Quantities And At The Same Time Have Additional Resources For The Future As Part Of The Familyrun Reifenhaumluser Group We Belong To A Group Of Companies With A Strong Financial Basis And A Strategy That Isn39t Focused On Fast Profits But Instead On Longterm Sustainable Growth We Look Forward To Contributing To This Future Growthrdquo For The Reifenhaumluser Group The Purchase Of The Westland Corporation Is A Clear Acknowledgment Of The Significance Of The American Market Bernd Reifenhaumluser Ceo Of The Reifenhaumluser Group Says Ldquoi Am Convinced That The Us Is An Important Strategic Market For The Reifenhaumluser Group And That Its Significance Will Continue To Increase In The Future By Acquiring Our Own Site For Screws And Barrels On Location And Investing In The Capacities Of The Site We Are Reacting To This Development In The Marketrdquo About The Reifenhaumluser Group The Reifenhaumluser Group Comprising Six Business Units Is The Worldrsquos Leading Manufacturer Of Plastics Processing Machinery In The Business Year 20112012 The Group Employing About 1200 People At Its Three German Sites Reported Total Revenues Of Eur 450 Million The Familyrun Company Was Founded In 1911 And Is Managed Today For The Third Generation By Brothers Bernd Klaus And Ulrich Reifenhaumluser Wwwreifenhausergroupcom About Reiloy Metall Reiloy Metall A Subsidiary Of The Reifenhaumluser Group Based In Troisdorf Is The Global Market Leader In Highly Wearresistant Screws And Barrels For Plastics Extrusion And Injection Molding The Company Founded In 1971 Is Managed By Thomas Porstner Wwwreiloycom About Westland Corporation Westland Corporation Based In Wichita Kansas Started Reworking Barrels For Extrusion And Injection Molding In 1969 The Company Would Later Develop Into A Market Leader For Highperformance Screws And Barrels The Company Became Part Of The Reiloy Business Unit Of The Reifenhaumluser Group On December 1 2012 Under The Name Reiloy Westland The Company Is Managed By Dave Larson Wwwreiloyusacom Press Relations Wolfgang H Houmlgemann Reifenhaumluser Gmbh Amp Co Kg Maschinenfabrik Head Of Pr Amp Advertising 53839 Troisdorf Phone 49 02241 23510768 Email Wolfganghoegemannreifenhausergroupcom

Rfid For Nonwoven Geosynthetics Rfid Labels From Schreiner Logidata Enable Efficient Road Reconstruction Cracks And Potholes Winter Takes Its Toll On Roads And Highways Heavy Traffic Can Cause Cavities To Form In Paved Roads In Low Winter Temperatures Water Seeping Into These Cavities Will Freeze And Expand When The Ice Melts The Asphalt Starts To Crumble Experts Sometimes Compare This Type Of Road Damage To Tooth Decay To Treat It Nonwoven Geosynthetics Are Used To Bond The New Surface With The Roadbed Polyfilld Equips These Asphalt Nonwovens With Rfid Labels From Schreiner Logidata For More Efficient Checks Of Road Surface And Roadbed Conditions With A Total Road Network Length Of 620000 Kilometers Maintenance Costs Are On The Increase Every Year In Germany Therefore Economical Reconstruction Methods And Innovative Materials Such As Nonwoven Geosynthetics Are In Demand Ldquononwoven Geosynthetics Are Inserted Between The Pavement And The Roadbed In The Process Of Repaving Roadsrdquo Explains Rainer Lugmayr Business Director At Polyfilld They Prevent The Intrusion Of Precipitation And Mitigate Crack Formation By Reducing The Stress Between The Upper Layers Of The Pavement And The Roadbed To Assess The Full Extent Of New Damage In Spring The Asphalt Has To First Be Checked And Samples Have To Be Taken Ldquobut Local Evaluations Are Very Complex And Costlyrdquo Adds Lugmayr Schreiner Logidata Together With Polyfilld Has Developed An Efficient And Costsaving Solution For Which The Geosynthetics Are Equipped With Rfid Labels The Rfid Chips Serve To Store Information About The Strengths And Structures Of The Various Road Layers And Materials Plus Road Construction Data And Additional Quality Characteristics To Read And Edit The Data Vehicles Are Equipped With Writeread Units Allowing The Information To Be Read Changed And Stored Again Onboard The Moving Vehicle Robust Rfid Labels For Extreme Demands Rfid Labels Used In These Special Applications Have To Resist High Mechanical Loads Ldquothatrsquos Why We Protect The Transponder With A Plastic Coating Which Prevents It From Breaking Under Isolated Pressuresrdquo Explains Johannes Becker Head Of The Schreiner Logidata Competence Center A Specialty Adhesive That Immediately Hardens Ensures Firm Bonding Of The Rfid Label To The Geosynthetic Material The Transponder Operates In The Highfrequency Range Which Allows Effective Reading And Writing Of Data Even In Deep Asphalt And Concrete Pavements Not Even Water Interferes With The Radio Waves Ldquothe Rfid Labels Have Proven Their Viability In Daily Use They Make All The Key Data Available To Road Maintenance Crews Which They Need For Assessing Road Conditionsrdquo Says Lugmayr This Results In A Massive Reduction Of Costs For Structural Examinations Schreiner Logidata Is Also Currently Working On An Ultrahigh Frequency Version Of The Rfid Label Due To The Higher Range The Data Could Then Be Conveniently Read Even From A Vehicle Moving At Higher Speed Media Contact Nicole Krestan Schreiner Group Gmbh Amp Co Kg Bruckmannring 22 85764 Oberschleiszligheim Tel 49 89 315845852 Fax 49 89 315845420 Nicolekrestanschreinergroupcom For Further Information Contact Schreiner Logidata A Competence Center Of Schreiner Group Gmbh Amp Co Kg Bruckmannring 22 85764 Oberschleissheim Germany Phone 49 89 315844140 Fax 49 89 315844109 Rfidschreinerlogidatacom Wwwschreinerlogidatacom

Plastics From Unconventional Sourcesthe Idea Of Making Monomers And Polymers From Sustainable Sources Is Rapidly Becoming Reality With Many Companies Targeting Rd Funds And Investment In This Field The Drivers Are To Save The Planet Reduce Carbon Footprint And To Develop A Longterm Viable Business The Market For Greener Materials Will Be Affected By The Discovery And Exploitation Of Shale Gas Which Supplies A Cheap Source Of Ethylene Precursors However Higher Carbons Are Not Found In This Resource And There Is A Shortage Arising Which Is A Further Factor Pushing The Search For New Sources Of Monomers Ami Provides An International Forum To Debate The Latest Market Developments And Technology Trends At Green Polymer Chemistry 2013 Which Takes Place From 19th To 21st March 2013 At The Maritim Hotel Cologne Germany Polymers Are Vital To The Global Economy From Cable Insulation Water Pipes And Medical Devices To Packaging And There Has To Be A Longterm Solution To Sourcing That Wont Run Out With Fossil Fuels The Additional Benefits Will Come From Finding Feedstocks That Are Waste Byproducts From Another Arena That Need Disposal Like Waste To Syngas Projects Work Is Continuing On Enzyme And Conventional Catalysis Of Biobased Feedstocks To Produce Conventional Plastics The Industry Is Used To Working With Petrochemical Sources So It Will Need To Adapt To Working With Agriculture Where There Are Different Issues In The Supply Chain Cargill Is One Of The Three Top Agricultural Companies In The World The Abc Of Adm Bunge And Cargill And Has Decades Of Expertise And Specialist Consultants To Advise Industry On Building A Suitable Supply Chain Poyry Management Consultants Has Conducted A Market Study Into The Future Prospects For Biobased Materials Linde Engineering Dresden Has Built Several Industrial Biorefineries To Supply The Polymer Industry Thailand Is Rich In Plant Material For Example It Has Excess Sugar Cane And Ptt Global Chemical Is Expanding From Its Conventional Petrochemical Feedstock To Looking At The Potential For Renewable Chemistrywood Can Be A Very Sustainable Source Of Materials And Sca Hygiene Products Which Manufactures Disposables Such As Diapers Is Involved In Research To Make Its Polymer Materials Using This Resource In The Netherlands Tno Is Leading The Bioconsept Project To Use Second Generation Biomass In Plastics Including A Pilot Scale Plant At Fraunhofer Igb For Lignocelluloses Conversion To Useful Chemicals Biomethodes In France Is Also Working In This Areathere Are Now Wellestablished Supplies Of Polymers Such As Polyamides And Polyethylene From Renewable Sources One Of The Leading Agricultural Universities In This Field Is Wageningen Ur In The Netherlands Where Current Research Projects Include The Discovery Of New Sources Of Polyamide Monomers Evonik Is One Of The Key Suppliers Of Biobased Polyamide The Current Cost Of Biosourced Materials Is Higher Than From Petrochemical Feedstock So Companies Like Taghleef Industries Which Are Manufacturing Films From Biobased Polyethylene Have Looked At The Market And The Value To Brand Owners Of The Sustainability Of Materials Another Option For The Specialty Film Market Is A New Biobased Tielayer From Yparexin Japan Toray Has Made A Big Breakthrough In Manufacturing Polyethylene Terephthalate Pet From Renewable Sources The Dsm Company Is Already Using Biosources For Several Of Its Polymers And One Of The Latest Developments Is In Unsaturated Polyester Resin For Composites Acrylics Have Been Later In Appearing In This Arena But Arkema Altuglas Has Just Announced A Breakthrough In This Field There Is An Eu Project On Making Thermoplastic Elastomers With Skz As One Of The Project Leadersthere Are Several Polymers Where Green Feedstocks Are Regularly Used And One Of Those Is Polyurethane Where The Polyol Can Be Sourced From A Variety Of Plants This Has Been Reviewed By Angela Austin Editor Of The Pu Magazine The Isocyanate Component Of Pu Is Much Harder To Synthesize From Nature Bayer Material Science Has Established Methods To Produce Polyurethane Using Co2 As The Base Materialone Big Area Of Interest Is The Use Of Co2 From Power Stations As A Feedstock And This Has Been Achieved By Several Major Chemical Companies Looking At Both General Hydrocarbons And Polymers The Latest Development Is Commercial Ventures Which Are Using Excess Renewable Energy To Convert The Co2 To Usable Hydrocarbons And By Doing So Providing A Form Of Energy Storage Co2 Is Of Great Interest As A Feedstock For The Polymer Industry As Using It Gives A Negative Carbon Footprint And Removes A Key Factor From The Global Warming Equation Plus There Are Abundant Sources In Iceland Carbon Recycling International Is Producing Potential Feedstock For Plastics In This Way Solvay Is Also Active In This Market Generating Hydrocarbons And Thus Storing Energy Siemens Is Leading The Field In Utilising Sustainable Plastics From Co2 Waste The Ami Conference On Green Polymer Chemistry 2013 Is A Forum For Environmental Debate On The Future Technology And Economics Of The Polymer Industrycontact For Further Informationdr Sally Humphreysbusiness Development Managerapplied Market Information Ltd Ami House 4547 Stokes Croft Bristol Bs1 3qp Uktel 44 117 924 9442 Fax 44 117 311 1534 Email Shamiplasticscomweb Site Wwwamiplasticscom

Nvc Panel Debate At Verpackung Hamburg Maximising The Pool Of Packaging Talentthe Quest For Packaging Talent In Germany And The Netherlands Is The Cornerstone Of Aunique Binational Nvc Panel Debate Which Will Take Place At The Packaging Exhibition Verpackung Hamburg 2013 The Debate Addresses Education Training And Qualifications In Packaging For All Companies And Organisations Involved In The Supply And Recycle Chain Of Packaged Productsthe Debate Focuses On The Quest For Talent In Packaging First We Will Address The Developments In Some Important Sectors Of Packaged Products Both Food And Nonfood Both Consumer And Industrial Based On This We Discuss The Education And Training Of Professionals In Packaging Via Dedicated Packaging Training Programmes Andor Generic Education Which Challenges Do We Have To Overcome How Can We Further Increase Our Competitivenesslast But Not Least The Interaction Between The Dutch And German Business Cultures Are Investigated Both Binationally And In The Context Of Multinational Companies And Their Quest For Talent How Can These Differences Be Exploited To The Benefit Of All Actors Involved In Packaging Developmentthe Timeschedule For The Debate Allows For An Optimal Visit Of The Verpackung And Packaging Innovations Hamburg 2013 During The Same Dayin The Afternoon All Participants Are Invited To Join The Verpackung And Pi Hamburg 2013 Gettogetherdrink At The Exhibitiondate And Timewednesday January 23rd 2013 First Day Of The Twoday Exhibition12001400 Hrslocationa32 1st Floor Hall A3 The Glasswindows Meeting Room Above The Exhibition Hall Inspection Officelanguagethe Presentations And Discussions Will Take Place In German Language Including Partially English Presentations And Supporting Dataorganisationnvc Netherlands Packaging Centre Wwwnvcnl Verpackung Hamburg 2013 Booth D12contact Charissa Koolen

International Award For Novel Label With Integrated Tamper Protection Tlmi Selects Schreiner Medipharmrsquos Pharmacomb Void Label For Innovator Award Schreiner Medipharm Was Able To Score Yet Again With An Intelligent Specialty Solution At This Yearrsquos Tlmi Awards Competition The Pharmacomb Void Label Received The International Innovator Award Of The North American Tag And Label Manufacturers Institute Furthermore The Twolayered Label With An Integrated Void Effect And A Detachable Label Part Secured The Firstplace Award In The Ldquoflatbed Screen Printing Categoryrdquo The Labels Were Developed With And For Sciclone Pharmaceuticals Inc Nasdaq Scln A Usbased Chinafocused Specialty Pharmaceutical Company For Its Product Zadaxinreg Thymalfasin An Immunostimulatory Agent For The Treatment Of Cancer And Hepatitis And As A Vaccine Adjuvant Every Year The Tag And Label Manufacturers Institute Tlmi Recognizes The Best Products Of The Label Industry Innovation As Well As Printing And Finishing Quality Are Aspects That Receive Particular Attention Schreiner Medipharm Convinced The Judges With The Pharmacomb Void Label And Won The Innovator Award Plus The Firstplace Award In The Ldquoflatbed Screen Printingrdquo Category Ldquothanks To Its Unique Design The Pharmacomb Void Label Prevents An Undetected Reuse Of A Vial With An Original Labelrdquo Says Ann L Merchant Global President Of Schreiner Medipharm Ldquothe Tlmi Accolades Underscore The Novelty Value And Technical Sophistication Of This Concept For Product Securityrdquo The Label Disintegrates Into Several Components When Used For The First Time In Addition When Pulling Off The Tear Strip That Wraps Around The Closure Cap Two Indicator Fields Are Exposed With The Words Ldquoopenedrdquo And Ldquousedrdquo This Helps Avoid Used Vials Being Refilled For The Purpose Of Selling Them As Perceived Originals Patients Are Thus Protected From Administration Of Substances That Are Ineffective Or May Even Be Harmful To Their Health Furthermore The Pharmacomb Void Label Offers A Valueadded Benefit To Healthcare Staff As The Integrated Label Part Can Be Used To Reliably Mark Filled Syringes For Further Information Contact Schreiner Medipharm A Business Unit Of Schreiner Group Gmbh Amp Co Kg Bruckmannring 22 85764 Oberschleissheim Germany Phone 49 89 315845400 Fax 49 89 315845422 Infoschreinermedipharmcom

Nbspnew Delhi 5th December 2012 Packagingconnectionscom Participates In The Latest Edition Of Packplus 2012 Fornbsp The Second Time As The Official Online Media Partner And Exhibitor The Premier Event Held At The India Expo Centre And Mart Greater Noida Uttar Pradesh India Fromnbsp 7th 10th December Lsquo2012 Will Feature Over 50 Product Launches 150 Running Machines From More Than 350 Exhibitorspackagingconnectionscom Will Be At The Epicentre Of The Event Buzz Showcasing Latest Innovations And Developments From The Industry Including White Paper And The Strategic Alliance With Design Tech To Offer End To End Packaging Solutions To Clients Innovative Products From Hpt Pharma And Heinz Glass Would Be Exhibited At The Stall The Premier Clients For The Company The Event Aims To Bring The World Of Packaging Processing Converting And Supply Chain Together At One Place One Can Meet The Packagingconnectionscom Team At Hall No 3 Stall No H04nbspmr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom Said Ldquothe Event Has Always Attracted The Best Minds In The Packaging Industry And Offers A Great Opportunity To Understand The Needs And Challenges Of The Segment The Event Offers An Excellent Measure Of The Size And Scale Of Packaging In India And Is An Essential Starting Point For Our Growth And Development Strategy We Hope To Use This Rare Occasion Where This Highly Fragmented Segment Comes Together To Develop Deeper Ties With The Fraternity And Expand The Packagingconnectionscom Global Network Even Furtherrdquonbspvisit Nbsphttpwwwpackagingconnectionscom To Know More About The Event And For The Latest In The Packaging Worldnbspabout Packpluspackplus Dedicates Itself In Offering The Best And The Most Important Packaging Expo Held In The Entire Region Of India The Exhibitors Who Are Involved In This Sector Find This Show To Be The Perfect Podium Where They Can Introduce New And Advanced Technology Aided Packaging Products Which Are Sure To Draw The Attention Of The Traders Coming To This Show Conference Sessions Are Held That Will Highlight The Essentials And Needs Of The Packaging Sector The Attendees Are Very Much Satisfied By The Exhibited Range And Maximum Of Them Have Shown The Desire To Visit This Show In The Future From The Past Editions Positive Reactions Are Received From The Attendees Which Motivate The Exhibitors As Well As The Organizers To Bring In Such Show In The Upcoming Years Apart From Packaging Processing Converting And Supplying Of The Products Are Also Discussed In This Podiumabout Packaging Connectionswwwpackagingconnectionscom Is Your Destination For Anything In Packagingwwwpackagingconnectionscom Is An End To End Solution Provider For Packaging The Skilled And Experienced Team Lead By Founder And Ceo Mr Sandeep Goyal Offers Consultation Innovation Customization And Execution In The Field Of Packaging The Company Specialize In Technical Packaging Solutions With Powerful Project Management Skills Their Exhaustive Network Of Designers Vendors And Stakeholders Allows For Best In Class Solutions For Every Budget Or Needthe Portal Is A Common Packaging Platform Connecting Packaging Professionals From All Across The Globe And The Ultimate Packaging Resource With Latest Innovations Research And Reports The Portal Also Hosts Buyer And Seller Offers Pinterviews And Offers Networking Opportunities With Key Decision Maker Buyers Sellers Users Amp Professionalsit Helps To Find Out Newer Business Opportunities In India Amp Worldwide And Promotes Direct Interaction Among Members Amp Visitorsthe Company Has Created Cutting Edge Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training With The Help Of Their Years Of Practical Industry Experiencenbspmedia Contactnbspanant Chhibbernbsptelnbsp 91 124 4965770email Anantchhibberpackagingconnectionscomnbspfor Further Details Contactamita Venkateshassociate Ndash Scientific Affairs And Consultancyamitavenkateshpackagingconnectionscomtelnbsp 91 124 4965784

Bioplastics Part Of The Next Industrial Revolution In Europe Eu Industrialpolicy Highlights Biobased Product Markets As Key Priorityberlin 18 October 2012 The European Commissions Recent Communication Onindustrial Policy Highlights Biobased Products As A Lead Market Triggeringsustainable Growth And Job Creation The Bioplastics Industry Represents Animportant Sector Of The Biobased Products Market And Our Industry Isplaying Its Part In Shaping This Century With Industrial Processes Sourcedfrom Renewable Raw Materials And Innovative Plastic Products With A Lowcarbon Profile Says Andy Sweetman Chairman Of European Bioplasticsthe European Commissions Communication States That The Biobased Marketswith High Demand And Favourable Legislative Framework Could Make Asubstantial Contribution To The Eus Transformation Into A More Sustainableeconomy The Right Legislation And Framework Conditions Will However Beneeded To Encourage Uptake Of Renewable Raw Materials For Industrial Use European Bioplastics Warmly Welcomes The Statement From Dgenterprisethe Bioplastics Industry Has Commercialised New Biobased Polymers Like Plaptt Or Starchbased Materials In A Second Wave Commodity Plastics Like Peor Pet Are Changing Their Raw Material Bases From Fossil To Renewable Thebioplastic Portfolio Covers Almost Everything From Shortlife Compostable Todurable Engineering Applications The Develoment Is Driven By Leadingedgeindustry And Demand From Brands Which Want To Innovate And Addresssustainability Issues Like Climate Change Explains Hasso Von Pogrellmanaging Director Of European Bioplastics The Most Relevant Question Foreu Policy Makers Right Now Is Where Shall These Investments Take Placemarket Data From European Bioplastics Reveal That The Bioplastics Productioncapacity Shows Its Highest Growth In South America And Asiain Order To Enable A Dynamic And Wellbalanced Development Andcompetitiveness Of The European Industry On The Global Stage A Supportiveframework Is Needed At Eu And Member State Level We Call On The Europeancommission To Implement The Proposed Lead Market Inititiativerecommendations Via Specific Policy And Market Measures They Will Fuelthose Innovative Industries That Antonio Tajani Vice President Of Theeuropean Commission Sees Creating The Next Industrial Revolution Foreurope Says Von Pogrell

Packplus Is Here With 50 Product Launches 100 Running Machines And Several Other Attractions Packplus 2012 The Total Packaging Processing Supply Chain Event Scheduled From 710 Dec 2012 Will Set A Complete Business Environment At India Expo Centre Greater Noida Presenting 250 Leading Exhibitors Under 4 Zones The Show Will Be A Catalyst For New Innovations And Developments In The Industry The Host Of Products All Set To Be Launched At The Show Includes Prestretch Film 8 Micron From Bandex Packaging P Ltd Wolke 8510 M600 Touch Advance Thermal Inkjet Printer From Videojet Technologies India P Ltd Color Amp Inspection Systems From Quadtech Inc Highfunctional Compact Photoelectric Sensors Bj Series From Autonics Automation India P Ltd Duplex Board Plant With 250 Ton Capacity From Ns Paper Ltd Optibondtrade Solutions From Nordson India P Ltd Ffb 300 Compact Desiccant Dehumidifier From Bryair Asia P Ltd And High Speed Shrink Packaging Amp Liquid Nitrogen Dosing From Vibgyor International P Ltd Insight Communication Amp Print Solution India P Ltd Will Present Somaeng Ci Flexo Press Premia Amp Imperia Solventless Lamiflex Lamination Slitter Amp Rewinder Pluto Eco Amp Pluto Lll Die Cutter Amp Flexo Plate Mounter Jungwon Extrusion Coating Single Extrusion Lamination And Co Ndashex Amp Tendem Extrusion Lamination Machine Nbg Printographic Machinery Co P Ltd Will Offer Automatic Diecutting Folder Gluer Amp Flute Laminator And Mothersonsumi Infotech Amp Designs Ltd Will Present Its All New Track Amp Trace Solutions From Pharma Food And Fmcg Sectors Running Live At The Show Will Be A Host Of Machinery And Equipment From Packaging Converting Processing And Supply Chain Industry On Demonstration Will Be The High Speed Vertical Form Fill Seal Machine From Bosch Ltd Total Processing System From Ishida India P Ltd Paper Corrugated Board Box Making Machinery Amp Printing Machinery From Neelkamal Machinery Company Printing Machines Metal Marking Machines Amp Screen Printing Machines From Naman Enterprises 3 Ply5 Ply Fully Automatic Corrugated Board Production Line From Natraj Industries And Strapping Machine From Vibgyor Technoplus P Ltd Shrink Packaging Systems P Ltd Will Display Automation Solutions Along With Medium Speed Shrink Wrapping Machines Shri Vinayak Packaging Machine P Ltd Will Present Packaging Machines Materials Amp Material Handling Equipments And Ace Products Will Offer Its High Quality Shrink Packaging Machines Other Running Machines At Packplus Will Include Pad Printing Machines From Artech Industries Die Punching Machine From Friends Engineering Company Digital Metal Detectors Amp Online Dynamic Checkweigher System For Food Amp Pharmaceutical Industries From Technofour Electronics P Ltd Paper Cup Machines From Avp Papers Uniop Make Hmi Touch Panels For Packaging Machines From Exor India P Ltd Premium Doctor Blades For Rotogravure Amp Flexographic Printing Machines From Convertech Equipment P Ltd Ndash Sa Flexible Packaging Machineries Amp Spm From Canara Flex Automation Of Packaging Machines From Motionman Electric P Ltd Paper Cup Amp Paper Plate Making Machines From Adco Print Pack India And High Speed Fully Automatic Hffs Free Falling Product Packing Machines From B M Packing Machines Goldlink Industries Co Ltd China Will Display Honeycomb Machines Rk Machine Tool Industry Will Present Fully Automatic Sticker Half Cutting Creasing Amp Perforating Machine Taniya Industry Will Offer Screen Printing Machines Amp Uv Coating Amp Curing System And Uflex Ltd Engineering Division Will Demonstrate Rotogravure Printing Machine Slitting Machine And Laminators Material Handling Equipments From Tech Mech Handling Equipments Total Healthcare Solutions From Parle Global Technologies P Ltd Paper Amp Packaging Testing Equipments From Unique Controls Paper Plastic Amp Packaging Testing Equipment From Rohit Instruments Amp Testing Services Solutions For Online Weighing And Volume Measuring Systems From Falcon Autotech P Ltd And Packaging Solutions For Solid Liquid Amp Viscous Products Ranging From 1 Gm To 10 Kg Pack Sizes From Nichrome India Ltd Will Also Be On Live Demonstration Other Highlights Of The Show Will Include Industrial Maintenance Aerosols Car Care Products Amp Self Adhesive Tapes From Twin Tech India P Ltd Industrial Air Cooler From Kapsun Resourse Corporation Solutions In Industrial Automation Amp Energy Conservation From Kudamm Corporation Hotmelt Adhesives Glue Sticks Amp Hotmelt Applicators For Various Industries From Uptodate Plastics And Packagings P Ltd Food Grade Hygenic Washable Plastic Modular Belts Slat Chains Amp Standard Conveyor Components From Ultraplast Chainbelts Pvt Ltd And Rubber Rollers From Max Rollers Rajdeep Automation P Ltd Will Display Encoders Timers Plcs Servo Drives Vfd Amp Position Indicators Simplex Control P Ltd Will Offer Automation For Packaging Industry Pyrotron India Inc Will Present Temperature Pressure Slow Level Control Systems Amp Automation Presto Stantest P Ltd Will Showcase Time Tested Testing Instruments And Servomax India Ltd Will Present Servo Voltage Stablizers Isolation Transformers Apfc Panels And Ups Systems The Finished Packaging Products Segment Of The Show Will Display Easily Openable Amp Ecofriendly Blister Pack Amp Innovative Clamshell Blister Packs For Better Product Presentation From Ecobliss India P Ltd Polyolefin Shrink Film From Ezeeflex Plastics P Ltd Cost Effective Label Solutions From Pac Edge Labels Paper Bags From Carry Well Packaging P Ltd Tin Containers Amp Boxes From Lalit Design Crafts P Ltd Customised Corrugated Boxes Amp Cartons From Vikas Packaging And Leaflets Booklet Hanger Duo Trio Rotary Dosage Labels From Reynders Label Printing India P Ltd Extending Their Support To The Exhibition Are Leading Associations Like Aidc Technologies Association Of India Hologram Manufacturers Association Of India Homai Uttar Pradesh Corrugated Box Manufacturers Association Upcbma Agro Amp Food Processing Equipment Amp Technology Providers Association Of India Aftpai All India Plastic Industries Association Aipia And Flexible Packaging Entrepreneursrsquo Welfare Association Fpewa The Packplus Core Team Is Also Organizing A New Format International Packaging Conclave To Be Held On 8th December 2012 At Greater Noida Running Parallel With The Second Day Of The Packplus Exhibition The Conclave Has Been Structured Around Panel Discussions And Round Tables Involving Packaging Managers And Global Packaging Lsquothought Leadersrsquo For More Details Visit Wwwpackplusin Or Email Us At Infopackplusin

Ccm Technology Arrives In Bangladesha Key Order For Sacmi From Globe Soft Drinks One Of The Countrys Biggest Local Bottlersa Dynamic Constantly Growing Market And A Toplevel Market Player One Of The Most Important Bottlers In Bangladesh Against This Backdrop Then Sacmi Has Fulfilled A Sizeable Order For Globe Soft Drinks Ltd For The Ast Beverage Plants Located In The Capital Of Dhakaone Part Of The Order Consists Of A Complete Line For The Production Of Csd Caps Pco1810 With An Output Rate Of 60000 Pieces An Hour The Heart Of The Production Line Installed And Started Up Early In 2012 Is The 64cavity Ccm The Flagship Machine In The Ccm Continuous Compression Moulding Series And Synonymous With A Technology With Which Sacmi Has Profoundly Innovated The Closures Industrycharacterised By Excellent Output Rates Up To 1600 Caps Per Minute This Sacmimade Compression Press Stands Out On Account Of Extremely Short Cycle Times And Highly Contained Energy Consumption Hence The Investment Decision By Globe Soft Drinks Which Aspires To Strengthen And Increase Its Market Shares In A Country Where Local Closure Production Still Falls Short Of Effective Demand And For Sacmi Important Progress Has Been Made On Asian Markets Where Constantly Changing Demand Is Matched By A Growing Need For Quality And Efficiency On Both The Product And Production Process Fronts

In The Foodservice Industry Superior Food Quality Is Critical Retailer Codes Of Practice Driven By Consumer Preferences Are Constantly Changing Loma Systems Is Helping St Clair Foods Expand Their Production Lines And Integrate New Processing Technologies To Help Them Stay One Step Ahead Of Customer Demands And Consumer Trendsst Clair Foods Is One Of The Premier Foodservice Providers For Salads And Entrees In The United States Managed Out Of Memphis Tennessee Since 1976 The Company Offers Hundreds Of Different Products From Their Signature Salad Dressings To Chilled Salads Dips Frozen Entrees And Side Dishes With Ldquoquality As The Main Ingredientrdquo According To St Clair Foodsrsquo Vice President Brian Edmonds Itrsquos No Wonder The Company Is Quickly Expanding Their Distribution Channels You Can Find The St Clair Brand In Restaurants Nationwide In Popular Retail Stores And Even On Television While The St Clair Brand Is Synonymous With Quality Private Label And Customformulated Products Are Becoming A Rapidly Growing Segment Of The Business No Matter How The St Clair Brand Reaches Your Table You Can Count On Their Awardwinning Delectable Tastesst Clair Foods Has Been A Loyal Loma Systems Customer For 20 Years A Relationship That Started Based On A Referral From A Fellow Foodservice Colleague So When St Clair Foods Approached Dave St John Regional Sales Manager For Loma Systems About Proactively Providing A Second Line Of Defense To Ensure Consistent Quality And Preserve Food Safety Standards He Immediately Paid A Visit To The Plant Ldquoindustry Food Safety Regulations Are Very Strict But Having Worked With St Clair Foods For Many Years I Know They Hold Their Products To Even Higher Standardsrdquo Said St John Ldquowith A Loma Systems Iq2 Harshliner Metal Detector Already On Each Of Their Six Production Lines We Needed To Implement A System That Would Complement Their Existing Technologyrdquoloma Systems Immediately Began The Task Of Mapping Out St Clair Foodsrsquo Operations From Receiving Raw Product Filling And Packaging For Distribution We Learned That Like Many Food Processing Facilities St Clair Foods Was Using The Loma Systems Metal Detectors As Offline Inspection Systems Running Large Finished 1230 Pound Containers Of Product At The Final Stage Of Production Ldquowe Called In Loma Systems Because Their Products Operate Extremely Well In Our Environmentrdquo Stated Dennis Spence Plant Manager For St Clair Foods Ldquowe Operate Our Production Areas At Very Cold Temperatures And Because Our Products Are Produced In Strict Accordance With Haccp Guidelines We Subject Our Systems To Harsh Wet Washdownsrdquofor The Past 10 Years St Clair Foods Has Scored 95 Or Higher On External Industry Sanitation Audits And They Arenrsquot About To Stop That Trend Ldquowersquove Put Our Loma Systems Iq2 Metal Detectors Through Some Tough Conditions And They Still Work Like They Are New They Are Definitely Rugged Systemsrdquo Continued Spenceafter Learning More About St Clair Foodsrsquo Production Process And Environment Conditions Loma Systems Immediately Recognized That Xray Inspection Was The Right Technology To Help The Company Adhere To Their Own Strict Standards For Product Quality Loma Systems Worked With St Clair Foods To Integrate Two X4 Pipeline Xray Inspection Systems One On Each Of Their Highest Volume Production Lines It Was Decided The Two X4 Pipeline Systems Would Be Placed Inline To Add An Extra Layer Of Protection At The Beginning Stage Of Production To Control The Quality Of Raw Productthe Two Highvolume Production Lines Run A Continuous Flow Of Product At High Flow Rates Blue Cheese Dressing Chunky Salsa And Potato Salad Are Run Between 15000 And 30000 Pounds Per Hour The Organic Nature Of These Products Is Not Consistent So Loma Systems Recommended A 3rdquo Pipe Width To Improve Product Flow Rates And Prevent Product Blockage Ldquowe Run Multiple Products On Each Line So It Was Important To Find A Xray Inspection System With Solid Product Memoryrdquo Said Spence The X4 Pipeline Systems Store Up To 10000 Unique Product Profiles And The System Will Autocalibrate Ready For Production Within 30 Secondsthe X4 Pipeline System Detects Metallic And Nonmetallic Contaminants Such As Glass Stone Calcified Bone Highdensity Plastics Flavor Clumps And Rubber Loma Systemsrsquo Xray Technology Also Measures Density Counts Components Identifies Missing Or Broken Products Monitors Fill Levels And Checks For Damaged Or Malformed Packaging Ldquoin The Food Processing Industry You Are Always At Risk Anything Can Happen At Any Time Our Goal Is To Mitigate That Risk And We Feel The Combination Of Metal Detection And Xray Technologies Will Play A Huge Role In Providing That Extra Level Of Protection For Our Customersrdquo Said Edmondsand Brian Edmonds Would Know Since He Currently Serves As The President Of The Refrigerated Foods Association Rfa St Clair Foods Is A Charter Member And Has Been Actively Involved With Helping Shape Food Safety Procedures For 33 Years Ldquoi Canrsquot Stress How Important It Is To Provide Safe Quality Foodrdquo Said Edmonds Ldquoi Recommend That Any Food Processing Facility Take A Multilevel Approach To Protecting Their Distributors Retailers Customers And The Reputation Of Their Brandrdquoldquosince Integrating The X4 Pipeline Xray Inspection Systems We Have Been Able To Share Our Results And Best Practices With Our Suppliers And Help Them Improve Their Processes As Well As A Result The Quality Of Raw Product We Receive Has Significantly Improvedrdquo Continued Edmondsst Clair Foods Can Now Capture Product Images Using Loma Systemsrsquo Proprietary Image Processing And 3d Modeling Technology With Speed And Reliability This Data Capture System Has Significantly Reduced The Number Of Contaminant Instances Found During The Final Stages Of Production Ndash Before Product Reaches The Consumer This Is Crucial In Protecting The Integrity Of The St Clair Brandas Part Of The Package Loma Systems Included Startup And Oneweek Of Onsite Training For Operators And Users Ldquoone Of The Key Reasons Our Implementation Went Smoothly Was The Startup And Onsite Trainingrdquo Said Spence Ldquowe Are Able To Use Our Xray Systems Without A Special Operator Our Own Team Can Operate Them Using The Icondriven Control Panelrdquohe Adds Ldquothe Loma Systems Service Team Is Very Accessible If You Have A Question They Are Just A Phone Call Awayrdquo St Clair Foods Is Also A Member Of Loma Systemsrsquo Premium Service Program With 5star Service And Support Itrsquos No Wonder St Clair Foods Trusts Loma Systems To Help Them Verify Food Quality Every Step Of The Way

Simple And Flexible Measurement Of Oeemobile Measuring System From Boschquick Overview Of Overall Equipment Effectivenessincreased Productivity Simple Identification Of Improvement Potentialautomated Measuring Without Operator Inputbosch Packaging Technology Builds Upon Its Services Portfolio With A Mobile Measuring System A Costeffective And Timesaving Method Of Capturing Oeerelevant Data For The Analysis Of Overall Equipment Effectiveness Oee It Enables Manufacturers To Gain A Rapid Overview Of The Oee Of Their Production Lines And Serves As A Basis For Equipment Optimization The Mobile Measuring System In The Form Of A Portable Box Can Be Used Both On Its Own And Together With Bosch Oee Consulting Service And Serves As A Basis To Decide If A Permanent Measuring System Should Be Implementedthe Mobile Measuring System Provides The Required Data On Output Speed Downtimes And Waste Across An Entire Line And Identifies Potential For Improvement To Increase Equipment Effectiveness And Productivity If Potentials Are Identified Bosch Determines Through Competent Oee Consulting Together With The Manufacturer The Main Causes Of The Deficits And Defines Next Steps To Address Themldquoincreasing Overall Equipment Effectiveness And Therefore Production Is Of Great Significance To Our Customers Purchasing Oee Measuring Systems To Identify Any Potential For Improvement Can However Be Very Expensive And Timeconsumingrdquo Explained Roland Pichler Oee Consultant From Bosch Ldquothat Is Why Our Mobile Measuring System Is An Ideal Solution For Our Customers It Can Be Easily Applied For A Predetermined Period Of Time And Shows Potentials For Improvement Quickly Simply And Costeffectivelyrdquothe Data Collection Requires No Operator Input In Order For The Measuring System To Capture Oeerelevant Data The Shift Model Is Loaded Into The Measuring System Control Unit Up To Eight Machine Components From Bosch And Third Parties Can Be Independently Connected Using Just One Interface Additionally The Measuring System Can Collect Data Directly From The Equipment Control System Using The Acquired Data The Potential For Improvement Of Each Machine Can Be Precisely Defineda Touch Panel Can Be Connected To The Measuring System To Display The Production Data This Enables Machine Operators To Manually Allocate A Cause Of Disruption To The Reports On Planned Machine Downtime Thanks To The Customized Software The Acquired Production Data Can Be Displayed Graphically For A Detailed Analysis Oee Consultants From Bosch Help Manufacturers To Analyze The Collected Data More Thoroughlywithin The Scope Of Boschrsquos Oee Consulting Service That Can Be Used In Conjunction With The Measuring System Productionlimiting Factors Such As Downtime Output Losses And Material Waste Can Be Determined Using A Structured Procedure Bosch Experts Investigate The Causes Of Effectiveness Losses Demonstrate Improvement Measures And Support The Implementation Of Customerspecific Solutions Bosch Works Closely With The Manufacturer And Utilizes Its Specialist Knowledge And Technical Expertise To Increase Productivity And Sustainably Optimize Profits

Next Generation Atlas Amp Titan Slitter Rewinders To Be Presented At Arabplast 2013 Atlas Converting Equipment Ltd Uk Is Pleased To Confirm Its Participation At The Arabplast 2013 Exhibition In Dubai Uae From January 7 Ndash 10 Inclusive On Stand 4d135 In Hall 4 The Company Will Present Its Lsquonext Generationrsquo Atlas Cw Series And Titan Sr9 Series Slitter Rewinders For A Wide Range Of Plain Coated And Printed Plastic Films Amp Other Flexible Materials Atlas Is A World Leader In Slitter Rewinder Technology For Processing Bopp Film And Has Installed The Widest Film Slitters At 10 Metres In Width In Four Different Locations Around The World Atlas Has The Fastest Film Slitters Running At 1500 Mmin At Web Widths In Excess Of 8 Metres The Company Has Built The Widest Slitter Rewinders For Cpp Film At Widths Of More Than 6 Metres And Bopa Film Slitters At More Than 5 Metres In Width In Recent Years Atlas Has Also Commissioned Several Primary Slitter Rewinders For Bopet Film The New Atlas Cw Series Technology Platform For Primary Slitter Rewinders For Plastic Film Amp Flexible Materials Will Be Presented At Arabplast 2013 The Cw1040 Amp Cw3600 Series Introduce The Next Generation Of More Compact Film Slitting Solutions From Atlas In Web Widths From 25 To 104 Metres 98 Ndash 410 Ins And Deliver Higher Efficiency Increased Productivity And Reliability Higher Quality Rewind Reels Reduced Noise Levels And More Effective Operatorfriendly Control Systems This Latest Atlas Technology Also Features Wireless Rewind Arm Positioning Automatic Knife Positioning Direct Drive Web Path Rollers And Running Speeds Of Up To 1500 Mmin 4920 Ftmin With More Precise Web Tension Control Electrical Cabinets Are Now Fully Integrated In To The Machines To Reduce The Space Required For Installation With Lsquounder Floorrsquo Service Trenches Also No Longer Required For The Primary Slitter Rewinders The New Titan Sr9 Series Slitter Rewinders Will Also Be Presented At Arabplast 2013 In The Development Of The Titan Sr9 Series Atlas Focused Its Product Development Strategy On Achieving Significant Reductions In Machine Downtime For Printers Amp Converters With Lower Operator Intervention And Also Reduction Of Costly Waste Materials Which All Adds Up To Outstanding Gains In Productivity The Concept Of The Titan Sr9 Series Technology Platform Features Three Separate Machine Modules Of Unwind Slitter Amp Rewind Sections The Idea Being That A Converter Need Only Change The Rewind Section Of The Machine From A Duplex Shaft Ds To A Single Turret St Or Dual Turret Dt Configuration To Meet Increasing Production Requirements Without The Need To Change The Existing Unwind And Slitting Modules The Titan Sr9dt Dual Turret Rewinder Was Launched At The End Of 2011 And The Duplex Shaft Ds Module Was Introduced Earlier This Year The Single Turret St Module Will Be Available Early In 2013 Innovative Engineering Design Has Led To The Application For Four Patents On The Titan Sr9 Series Including The Unique Turret Support Device Tsd For Faster Turret Rotation On The Dt Model Such Advanced Engineering Design Has Led To Significant Improvements In The Quality Of Slit Reels And Significant Reductions In Setup Procedures A Newly Designed Linear Tracking Slitter Lts Section On All Sr9 Modules Ensures The Shortest And A Constant Web Length Between The Knives And The Rewind Shafts For Improved Web Control Giving The Highest Possible Side Wall Quality Of Rewind Reels Which Also Reduces The Possibility Of Waste Material Between All Three Versions Of The Titan Sr9 Platform Many Other New Features Provide Exceptional Performance And Productivity At Running Speeds Of Up To 1000 Mmin 3300 Ftmin The Sr9 Series Is Available In Two Widths 1650 And 2250mm 65 Amp 88 Ins To Maintain Focus On Its Objectives For Sustainability The Titan Sr9 Series Has Many Features For Achieving Reductions In The Cost Of Energy And Of Waste Materials Elimination Of All Hydraulics Helps To Provide A Cleaner Environment And The Use Of High Efficiency Motors And Regenerative Braking Enables A Considerable Reduction In Energy Consumption And Makes The Sr9 Series The Most Efficient Slittingrewinding Solution In The Titan Range The Titan Sr9 Series Is Set To Smash All Productivity Records And Provides A Genuinely Flexible And Sustainable New Approach To Slitting And Rewinding A New Service Platform For Both The Atlas Amp Titan Range Of Slitter Rewinders Provides Expanded Global Customer Service Amp Support Operations With Engineers Not Only Based In The Uk But Also In The Usa Latin America India And In China Atlas Amp Titan Can Also Provide Fully Automated And Integrated Roll Handling Systems To Meet Specific Production Requirements

Biopolymer Packaging Film Processing With The Latest Ltmduo Line Combination In Partnership With Theegarten For Packaging Chocolate Bars In Tubular Bags With Following Display Cartoning New Wkm2 Display Cartonernumerous New Products At Prosweets 2013 In Colognealtendorf 29112012 At The Prosweets Trade Fair In Cologne From 27 To 30 January 2013 Loesch Verpackungstechnik Gmbh From The Franconian Town Of Altendorf Is Headlining Its Claim To Global Leadership In The Packaging Machinery Market Quotwe Will Be Presenting Numerous Innovations In Hall 101 Ndash Stand G030h031quot Says Loeschpack Managing Director Andreas Graf One Such Innovation The Company Is Showcasing Is Its Lrk High Performance Robotic Cartoning System With A Tubular Bag Machine From Theegartenpactec Quotwith The Fpc5 Tubular Bag Machine From Our Competent Partner And Our Flexible Powerful And Modular Lrk Cartoning System For Erecting Filling And Sealing Display Folding Boxes We Offer Customers A Highly Efficient Line Combination For Tubular Bagsquot Says Graf Who As A System Supplier Is Increasingly Focusing On Complete Solutions From A Single Sourceone Highlight The Market Is Eagerly Awaiting At Prosweets 2013 Is The Next Generation Of The Successful Ltmduo We Have Implemented Numerous Modifications And Developments Relating To Performance Packaging Quality And Format Changeovers In The Latest Generation Of Our Fold Wrapping Machine For Chocolate Tablets And Bars Loeschpack Is Extremely Proud To Be Presenting The First Ltmduo Which Can Process Biopolymer Packaging Films To Customers In Cologne The Machine Represents The Achievement Of A Longstanding Objective And Once More Demonstrates Loeschpack39s Capacity For Innovation With This Development Loeschpack Takes Another Stride Towards Sustainable Packaging Technology And Is Expecting Outstanding Feedback From The Market Loeschpack Already Provides Carbonneutral Machines Which Allow The Packaging Machine Manufacturer To Offset The Emissions Caused By Its Machines Through Certified Climate Protection Projectsgraf Sees A Genuine Recipe For Success In Partnerships With International Customers Quotclose Cooperation With Customers Ensures That We Can Quickly And Efficiently Transform Packaging Ideas Experience From Production And Suggestions From The Market Into New And Refined Productsquot This Approach Is Also Reflected In The Latest Generation Of The Wkm2 High Performance Display Cartoner Quotthe Wkm1 Has Been A Resounding Success For Many Years And We Are Now Building On This Success With The Completely Revised Wkm2quot Says Product Manager Martin Bauer Referring To The Outstanding Priceperformance Ratio With Quotwraparoundquot Cartoning The Cantilevertype Servodriven Machine Design Guarantees Excellent Standards Of Hygiene And Ergonomics By Completely Separating The Drive And Product Areas The Wkm2 Features Great Size Flexibility And Simple Format Changeovers Quotin Addition To The Chewing Gum Segment This Enables Us To Develop Other Areas Of Application In Chocolate And Confectioneryquot Says Andreas Grafthe Loeschpack Team Is Looking Forward To Presenting The Numerous New Products As Well As To Constructive Discussion With The Trade Visitors Over 350 Exhibitors From 30 Countries Are Expected At Prosweets 2013 Prosweets Has An International Reputation As An Innovation Forum And Together With The Fact That It Is Held Simultaneously With The Ism In Cologne Is An Ideal Platform For Loeschpackabout Loesch Verpackungstechnikloesch Verpackungstechnik Gmbh Is An International Manufacturer Of Packaging Machinery And Systems Located In The Upper Franconian Town Of Altendorf As A Subsidiary Of The Piepenbrock Group The Company Offers Integrated Solutions For Customerspecific Packaging Systems At The Same Time Loeschpack Offers The Entire Spectrum Ndash From Individual Machines To Multilevel Complex System Solutions The Companyrsquos Product Range Includes Packaging Machines For The Food And Nonfood Sectors Loeschpack Is Particularly Specialised In The Packaging Of Chewing Gum Chocolates And Dry Baked Goods Loeschpackrsquos Cuttingedge Production Methods And Comprehensive Quality Management Are The Foundation On Which Its Sophisticated Hightech Economical And Highquality Machinery And Equipment Are Builtloeschpack Takes Responsibility Ndash Also For The Environment Through The Use Of Innovative Technology Solutions The Company Is Able To Deliver Complex Applications With Substantial Energy Savings Under The Label Ldquocarbon Neutral Packagingrdquo Loeschpack Already Offers Customers Carbonneutral Machines Any Emissions Released During The Value Creation Process Are Offset Through Climate Protection Projects Ndash And Confirmed By A Certificate Issued By A Neutral Third Party In Addition Loeschpack Plants Trees In Piepenbrock39s Rheinshagen Forest Ensuring Carbonneutral Operation Of Its Machines At Customer Sitesdiscover More About Loeschpack Athttpwwwloeschpackcomnbspdiscover More About Piepenbrock Athttpwwwpiepenbrockdecaptionsbull Ltmduo Image Loeschpackjpgltmduo Now Designed For The Use Of Biopolymer Packaging Filmbull Wkm2 Image Loeschpackjpgwkm2 High Performance Display Cartonerbull Company Image Loeschpackjpgloeschpack Headquarters In The Upper Franconian Town Of Altendorf

Finland Based Company Eltete Tpm To Deliver Technology To Produce Cartonboard Pallets In Japaneltete Tpm Engineering The Machinebuilding Division Of Eltete Tpm Group Will Deliver Paperrolltopaperpallet Amp Appa Automatic Paper Pallet Assembly Technology To Nagoya In Japan In Spring 2013 The Capacity Of The Factory Will Be Approximately 3 Million Cartonboard Pallets Per Yearas A Result Of This Transaction The Manufacture Of Cartonboard Pallets Components And Transport Packaging Materials Will Also Now Be Localised In Japan In Accordance With Eltete Tpmrsquos Global Concept And Vision This Transaction Is Significant For Us Because It Will Open The Japanese Market Up To More Factories The Service Network In Japan Will Be Improved By Means Of Local Automatic Pallet Assembly Lines The Importance Of The Deal Is Also Increased By The Fact That Our Cooperation With Globallyoperating Japanese Multinationals Will Intensify Says Company Ceo Bo Oumlsterman Our Aim Is To Introduce Appa Machinery Which Represents The Latest Technology All Over The World And To Make It Into The First Global Standard For Cartonboard Pallets The Order Now Received From Japan Is An Exceptionally Good Achievement In The Right Direction And Will Be The First Of Its Kind In Japan In Accordance With Our Plans We Are Strongly Pursuing Our Goal And This Deal Is Proof That We Are At The Cutting Edge Of Our Field Globally Both In Terms Of The Product And Technical Expertise Adds Mr Oumlstermanin Eltete Tpmrsquos Overall Concept The Manufacture Of Environmentallyfriendly Transport Packaging Materials Strong Product Development And The Machine Building That Supports It Have Enabled The Company To Succeed In Its Aims For Expansion Local Manufacture A Global Spread And Products Based On Sustainable Development Have Been Increasing In Significance Which Will Continue To Promote The Companyrsquos Efforts Into The Future In Recent Years The Development Of Eltete Tpmrsquos Sales Has Been Positive And At Present The Companyrsquos Own Production Network Covers 21 Factories In 15 Different Countries

Clariant Showcases Efficient Ed Pigments Mumbai October 31 2012 Ndash Clariant A World Leader In Specialty Chemicals Showcased The Lsquoeasily Dispersible Pigments Rangersquo At The Paint India 2012 Outreach Conference In Chennai Recently Mr Nitin Vaidya Head Ndash Technical Services Pigments Ndash Coatings Business Clariant Chemicals India Limited Incorporating The Theme Of Quotbetter Raw Materials For Better Coatingsquot Touched Upon Very Crucial Points For The Industry But What Was More Captivating Were The Benefits For The Economy And The Ecology As Well Clariantrsquos Special Organic Pigments Can Be Easily Incorporated Into Paint Systems With A Dissolver Lowering The Manufacturing Cost By Reducing The Grinding Period Thus Saving The Energy Otherwise Pigment Dispersing In The Conventional Method Is A Very Specialized Time Consuming And Expensive Process Which Requires Highpriced Technical Equipments And Knowhow As Well Almost 220 Technocrats Were Present From Different Companies Including Asian Paints Kansai Nerolac Akzo Nobel Basf Nippon Paints Mrf Coatings Etc Ed Pigments Ed Pigments Can Be Dispersed With High Speed Dissolver Using Cowles Blade With No Additional Milling To Achieve Optimum Colour And Strength On The High Speed Dissolver The Pigment Goes Through A Special Surface Treatment With A High Efficiency And Wide Compatibility Additive During The Manufacturing Process Ed Pigment Can Also Be Dispersed Using Bead Mills At Reduced Dispersion Time Compared To That Required For Conventional Pigments Three Ranges Of Ed Pigments Are Available Viz Eds For Solvent Borne Coating Edu For Solvent And Water Borne Coatings And Edw For Water Borne Coatings Opined Mr Tej Dialani Head Of Salescoatings Amp Tinting Systems Ndash India Sub Region Pigments Clariant Chemicals India Limited Ndash Ldquoed Pigments Is Part Of Our Global Initiative And Is Positioned As One Of The Key Product Range In Our Growth Strategy Matching The Industry Evolving Needs And Demands Is What Clariant Stands For And Ed Pigments Are One Of The Hallmarks Of Our Innovative Solutions For Our Customerrdquonbspcorporate Media Relationskai Rolkerphone 41 61 469 6363kairolkerclariantcomnbspnbspstefanie Nehlsenphone 41 61 469 6363stefanienehlsenclariantcomnbspnbspnbspmedia Relationsphilips Abrahamphone 91 22 2531 54 16philipsabrahamclariantcom

The Heat Is Onthe Packplus Visitor Registrations Are In Full Swing Exhibitors Are Busy Sending Invitations To Their Customers Organisers Are Occupied With Promotional Activities The International Speakers Are Scheduling Their Travel Plans For Conclave The Hotels At Greater Noida Are Busy With Reservation Enquiries And The New Venue With All Its Anticipation Looks Forward To Host Packplus 2012 Yes The Countdown Has Begunwith 200 Already Signed Up Companies Packplus The Total Packaging Processing Amp Supply Chain Event Expects To Feature More Than 250 Exhibitors In Its 2012 Edition Presenting Ten Niche Shows Under Four Zones The Exhibition Is Scheduled From 710 December 2012 At India Expo Centre Greater Noidathe Indian Packaging Industry Growing At A Rate Of 15 And Holding The 11th Position In The World Packaging Industry Is Expected To Grow At A Rate Of 1819 By 2015 This Growth Is Expected To Be Driven By Increased Demand From The Food Amp Beverages And Pharmaceutical Industries The Food And Beverage Industry Is Expected To Fuel Demand For Active Packaging Materials While The Pharmaceutical Industry Is Projected To Substantially Increase Demand For Smart Packagingpresenting This Optimistic Picture Of The Industry The Packaging Zone At Packplus Will Provide A Global Platform To Latest Innovations Amp Developments From Companies Like Akr Plastic Industry Avp Papers Bhavmark Systems P Ltd Bosch Ltd Domino Printech India P Ltd Inpack Fabrications P Ltd Nordson India P Ltd Pakona Engineers India P Ltd Uflex Ltd Holography Division Unitech Engineering Company Vibgyor International P Ltd Acg Worldwide Spheretech Packaging India P Ltd Bandex Packaging P Ltd Bm Packing Machines Banner Engineering India Cyklop Packaging Systems India P Ltd Ecobliss India P Ltd Ishida India P Ltd Millenium Packaging Solutions Nichrome India Ltd Superpack Packaging Machines P Ltd And Valco Melton Engineering I P Ltd To Present Innovations Amp Developments From Renownedthe Converting Zone Of The Exhibition Featuring India Converting Show India Corrugated Show And India Flexo Show Will Present Companies Like Accuweb Enterprises Creed Engineers Enigma Ventures P Ltd Expert Industries P Ltd Global Graphics Machineries P Ltd Isra Surface Vision Ndash Gmbh Kody Equipments P Ltd Mehta Cad Cam Systems P Ltd Pelican Rotoflex P Ltd Shilp Gravures Ltd Sp Ultraflex Systems P Ltd Uflex Limited Engineering Division Ars Automat Insight Communication Amp Print Solution India P Ltd And Quadtech Incfood Technology Show Pharma Technology Show And Automation 4 Packaging Will Come Together Under The Processing Zone Of The Exhibition Some Of The Leading Automation Industry Players Have Chosen The Platform To Showcase Latest Trends Across The Packaging Value Chain Exhibiting In The Segment Will Be Companies Like Parker Hannifin India P Ltd Siemens Ltd Autonics Automation India P Ltd B Amp R Industrial Automation P Ltd Exor India P Ltd Kudamm Corporation S A Automation P Ltd And Simplex Controls P Ltdthe Acceleration In Industrial Production And Changes In Consumption Patterns Have Resulted In A High Demand For Basic And Specialised Supply Chain Management Presenting A Runup Of The Highly Potential Industry The Supply Chain Zone At Packplus Will Host Bulk Pack India Logistics Show And India Aidc Show With Companies Like Time Technoplast Ltd United Enterprises Tech Mech Material Handling Equipments Kanpur Plastipack Ltd Vivyd India And Schoeller Arca Timeldquowith Packplus Around The Corner The Environment Is Full Of Activity The Team Is Working On Several Promotional Campaigns Through Invitations Newsletters Emailers Smses Telecalling Transit Advertising And Media Coverage Visitors From All Over India And Neighbouring Countries Are Registering Themselves For The Exhibition We Are All Set For A New Landmarkrdquo Said Neetu Arora Director Printpackagingcom P Ltd The Organizers Of The Showthe Packplus Core Team Is Also Organizing A New Format International Packaging Conclave To Be Held On 8th December 2012 At Greater Noida Running Parallel With The Second Day Of The Packplus Exhibition The Conclave Has Been Structured Around Panel Discussions And Round Tables Involving Packaging Managers And Global Packaging Lsquothought Leadersrsquo

Online Video 5l Edible Oil Bottle Blow Molding Machine Full Automatic And 2 Cavitieshttpyoutube5cqektwinq8for Big 5l Bottles We Have Full Automatic Blow Molding Machine 2 Cavities About 1400bph I Am Looking For Business Partners To Help Us To Promote Sales Of This Machine In Their Local Market Edible Oil Factories Will Buy This Machine To Make Their Oil Bottles If You Are Interested Please Contact Us For Discussion On Business Partnershipnbspnormally 5l Bottle Is Widely Used For Edible Oil Drinks Etcnbspfor More Details Please Visit Our Website Httpwwwkintlscomcontact Oscar Huangkingtop International Group Ltdemail Kintlcngmailcom Httpswwwfacebookcombottleblowmoldingmachinenbspnbsp

New Vector Resealable Matrx Delivers Convenience Consumers Can Hear And Feelproduct Unveiled At Pack Expo International 2012chicago Il October 29 2012 The New Zippak Vector Resealable Matrix From Zippak The Global Leader In Materials And Machinery For Resealable Packaging Brings A New Level Of Consumer Convenience To Flexible Packaging Featuring A Proprietary Selfsealing Matrix That Closes Securely Without Exact Alignment Of Opposing Segments The Solution Provides Tactile And Audible Feedback For Reassurance Of Complete Fastening With Each Use The Airtight Seal Also Helps Lock In Product Freshnessas The Only Resealable Closure Supplier With An Inhouse Equipment Division Zippak Systems The Company Developed The Vector Resealable Matrix For Integration Into Existing Flexible Packaging Lines With Only Minor Modifications To Machinery For Brand Managers Retailers And Converters The System Minimizes Investments In Capital Equipment And Downtime Zippak Also Offers Extensive Consultation To Consumer Product Goods Companies And Store Brands Transitioning Into Resealable Flexible Packaging Or Launching New Productsselfmating Closures Are An Easytouse Alternative To Traditional Zipper Profiles And Are Gaining Tremendous Traction With Brand Managers Retailers And Consumers Says Robert E Hogan Director Global Marketing At Zippak Zippak Has Combined Its Exclusive Focus On Quality Resealable Closures For Packaging And Extensive Machinery Knowledge To Design The New Vector Resealable Matrix And Application System Ensuring A Seamless Transition To A Consumerpreferred Solutionfrom Shredded And Sliced Cheese Deli Meat Snacks Cereal Candy And Vegetables To Pet Foods And Garden Fertilizer Vector Resealable Matrix Is Ideal For A Variety Of Applicationsvector Resealable Matrixs Ability To Mate To Itself Will Also Advance New Packaging Concepts That Require A Selfsealing Closure Including Pour Lok And Zip360pour Lok From Innoflex Allows Products To Be Poured From The Side Gusset Of A Package Making It A Consumer Convenience Enhancement For A Range Of Dry Goods In Large Format Pouches Unique To Zippak And Its Licensed Partners Pour Lok Can Be Preapplied Using Innolok Equipment And Can Run On Standard Vertical Form Fill Seal Vffs Machines With A Simple Side Gusset Modificationzip360 Is A Widemouth Pouch Format That Features A Vector Resealable Matrix Around The Entire Opening Enabling Easy Access To Contents And Simple Closure The New Pouch Formats Widemouth Opening Allows Consumers Of Snacks Frozen Products Cookies And Crackers And Pet Food And Treats To Easily Access And Scoop Contents With Space For Graphics Around The Entire Surface Area Of The Pouch Zip360 Also Maximizes The Pointofpurchase Impactlike All Of Zippaks Resealable Flexible Packaging Solutions Vector Resealable Matrix Eliminates The Need For Consumers To Transfer Contents Into A Separate Unbranded Container Keeping Marketing Messages In Front Of The Consumer To The Last Use