Russias Trade Fairs For Plastics And Packaging Offer Major Opportunities For Exportfocused Companies Interplastica And Upakovkaupak Italia Invite Exhibitors From All Around The World To Moscow The Russian Economy Is On The Up In 2011 The Gross Domestic Product Rose By 4 Per Cent Consumer Spending By 5 Per Cent And Investment In Production Sites And Equipment By 6 Per Cent Even If The Dynamic In The Current Year Has Weakened A Little The Signs Continue To Be Positive And The Mediumterm Prospects For Many Industries Are Very Promising The Plastics And Packaging Sectors In Particular Benefit From This Favourable Development And Experts Predict Continued Great Potential For Both Industries Nationwide Capacities In The Packaging Sector Are Being Extended And Plants Modernised In Particular The Food And Drink Industry Is Seeing Processed And Packaged Foods And Convenience Products Becoming Increasingly Popular Packaging Plays An Important Role In The Entire Consumer Goods Sector In Russia Not Only Acting As A Protective Container For Storage And Transportation But Also For The Marketing And Presentation Of Products The Development Of Key Consumer Industries Is Also Leading To Growing Demand In The Plastics And Rubber Industry The Packaging Sector Is Of Course Of Great Significance And The Construction Industry Has Also Been Revitalised Primarily As A Result Of Extensive Nationwide Renovation And Modernisation Measures For Which For Example Insulation Material Piping Window Frame Products Etc Are Needed Many Small And Mediumsized Companies Have Sprung Up In The Past Few Years Investing In The Expansion Of Existing Capacity And The Creation Of New Factories Not Least Due To State Support These Positive Future Prospects Will Be Of Great Benefit To The Exhibitors At Interplastica 2013 The Most Important Platform For Plastics And Rubber Technology In Russia And Upakovkaupak Italia Russias Leading Trade Fair For The Packaging Industry Exhibitors From Around The World Are Invited To Both Events Which Will Take Place From 29 January To 1 February In Moscows Trade Fair Centre Expocentre In Krasnaya Presnya To Showcase Their Products And Services To The Promising Russian Market There Is Already An Active Demand For Exhibition Space The Synergy Of The Two Trade Fairs Has Proved Itself Over Many Years They Perfectly Complement Each Other In Terms Of What They Offer And Their Target Visitor Group Well Over 800 Exhibitors Are Expected And The Two Events Will Occupy A Net Exhibition Space Of More Than 16000 Square Metres About 20000 Visitors From Across Russia And Many Cis Countries Came To The Previous Events In 2012 The Exhibitors Consistently Reported Interesting And Promising Discussions A Positive Number Of New Customers And Onthespot Deals Companies From The Plastics And Rubber Industry And Providers Of Packaging Machines Machines For The Food Industry Packaging And Accessories Have Until The Beginning Of October To Register For Interplastica 2013 Andor Upakovkaupak Italia 2013 Further Information Is Provided On The Internet At Wwwinterplasticade And Wwwupakovkaupakitaliade And From Messe Duumlsseldorf Gmbh Stefan Koschkeclaudia Wolfgram Interplastica Koschkesmesseduesseldorfde Wolfgramcmesseduesseldorfde Tel 49 0 21145 607768 And Thomas Frankenmarieluise Schlaumlfke Upakovkaupak Italia Frankentmesseduesseldorfde Schlaefkemmesseduesseldorfde Tel 49 0211456077397741

Fachpack 2012 Elematic 3000 S Case Packer From Bosch To Handle Glass Jars Reliability And Efficient Production Careful Product Handling Maintains Quality And Reduces Risk Of Breakage Regular Product Flow Boosts Efficiency At Fachpack 2012 In Nuremberg Germany Hall 4a Booth 304 Bosch Packaging Technology Presents A New Application Of Its Elematic 3000 S Case Packer Which Is Engineered To Handle And Place Glass Jars Into Tray And Hood Secondary Packaging This Version Of The Machine Was Designed By Bosch To Meet The Needs Of Rapunzel Naturkost The German Manufacturer And Supplier Of Organic Products It Suits Manufacturersrsquo Needs For An Efficient And Reliable Secondary Packaging System For Their Glass Products High Product Protection Designed To Protect Fragile And Easily Breakable Glass Jars And Reduce The Risk Of Downtime Any Machine Parts That Come Into Contact With Product Are Made Of Plastic In Addition The Machinersquos Infeed Is Surrounded With Protective Covers Eliminating The Risk Of Jars Falling To The Floor And Breaking Thanks To The Wrap Around Technology Jars Are Gently But Tightly Packed Minimizing The Risk Of Product Damage As They Are Transported To Retailers Maintaining Production Line Efficiency The Case Packer Elematic 3000 S Can Be Easily Adjusted To Match The Preceding Filling Machinersquos Speed Without Affecting Efficiency On The Production Line Jars Are Transported From The Filling Machine To The Elematic 3000 S Via Two Lanes With Each Lane Carrying A Maximum Of 95 Jars Per Minute The Machine Also Features A Special Grouping System Which Includes An Accumulation Area To Help Regulate The Delivery Of Products To The Machine And Ensure That Product Flow Is Consistent Quick Format Changeover And Easy Accessibility The Modular Design Of The Elematic 3000 S Combines A Packaging Tray With Lid And A Full Wrap Around System Enabling The Operator To Switch Quickly Between The Two Formats And Speeding Up Changeovers The Machine Is Capable Of Packaging A Variety Of Different Sizes Including 250 400 500 And 750 Gram Jars The Design Of The Machine Is Transparent Allowing Operators To Quickly Identify Any Issues To Facilitate Repairs When Necessary All Parts Of The Machine Can Be Easily Reached The Mis Maintenance Information System Informs The Operator About Pending Maintenance Jobs And When They Will Need To Be Done Press Photo 1pa18629 1pa18630 Contact Contact Person For Press Inquiries Bernhard Vaihinger Johanna Marquette Phone 49 7151 700762 Phone 49 711 81158501 The Bosch Division Packaging Technology Based In Waiblingen Germany Is One Of The Leading Suppliers In The Field Of Processing And Packaging Technology In More Than 15 Countries Worldwide It Develops And Produces Complete Solutions For The Pharmaceutical Food And Confectionery Industries The Comprehensive Service Portfolio Completes The Package The Worldwide Sales And Service Network Offers Local Contacts More Information At Wwwboschpackagingcom The Bosch Group Is A Leading Global Supplier Of Technology And Services In The Areas Of Automotive And Industrial Technology Consumer Goods And Building Technology More Than 300000 Associates Generated Sales Of 515 Billion Euros In Fiscal 2011 The Bosch Group Comprises Robert Bosch Gmbh And Its Roughly 350 Subsidiaries And Regional Companies In Some 60 Countries If Its Sales And Service Partners Are Included Then Bosch Is Represented In Roughly 150 Countries This Worldwide Development Manufacturing And Sales Network Is The Foundation For Further Growth Bosch Spent Some 42 Billion Euros For Research And Development In 2011 And Applied For Over 4100 Patents Worldwide With All Its Products And Services Bosch Enhances The Quality Of Life By Providing Solutions Which Are Both Innovative And Beneficial The Company Was Set Up In Stuttgart In 1886 By Robert Bosch 18611942 As Ldquoworkshop For Precision Mechanics And Electrical Engineeringrdquo The Special Ownership Structure Of Robert Bosch Gmbh Guarantees The Entrepreneurial Freedom Of The Bosch Group Making It Possible For The Company To Plan Over The Long Term And To Undertake Significant Upfront Investments In The Safeguarding Of Its Future Ninetytwo Percent Of The Share Capital Of Robert Bosch Gmbh Is Held By Robert Bosch Stiftung Gmbh A Charitable Foundation The Majority Of Voting Rights Are Held By Robert Bosch Industrietreuhand Kg An Industrial Trust The Entrepreneurial Ownership Functions Are Carried Out By The Trust The Remaining Shares Are Held By The Bosch Family And By Robert Bosch Gmbh Further Information Is Available Online At Wwwboschcom And Wwwboschpresscom

Nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspget Linkedin With The Latest On Packagingconnectionscom Grouppackagingconnectionscom Ndashinvites Packaging Industry Fraternity To Join Them On Linkedinnew Delhi 14th August 2012 Packagingconnectionscom Group On Linkedin Is An Excellent Networking Tool The Group Is A Great Place For Networking Discussions And Ideation And Thousands Of Active Members Share The Latest Information And Pearls Of Wisdom About The Packaging Industry The Group Is An Excellent Forum For Seeking Solutions From Experts Across The Globe It Is Frequented By Suppliers Buyers Vendors Businesses Consultants And Experts From The Industrymr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom And Owner Of The Group Said Ldquothe Packaging Industry Globally Is Very Fragmented The Group Is A Friendly Community Of Experts That Welcomes And Nurtures New Ideas Discussions And Members It Is An Essential Resource For Anyone Involved With Packagingrdquo Nbsplogon To Httpwwwlinkedincomgroupspackagingconnections1588847 To Be Part Of This Exceptional Packaging Fraternity About Packaging Connectionswwwpackagingconnectionscom Is Your Destination For Anything In Packagingwwwpackagingconnectionscom Has Its Expertise In Technical Packaging Solutions With Powerful Project Management Skills Coordinate The Whole Project With Designer Vendor And Stakeholders Successful Handling And Implementing Projects On Outsourcing Model Is Their Specializationan Entrepreneurial Company Started By Young But Experienced Packaging Technologist Mr Sandeep Goyal Who Has Worked With Leading Mncs Amp Indian Companies Both As A User And A Supplier Of Packaging Materials From Its Inception The Company Was Powered With An Ultimate Vision To Be A Common Packaging Platform To Connect Professionals From All Across The Globe In Order To Realize This Dream Packaging Connections Has Continuously Strived To Bring The Latest Resources From All Over The World To The Doorstep Of Packaging Industrythe Portal Offers Resources Like Buyer And Seller Offers Pinterviews Innovations Key Decision Maker Direct Contacts Online Reports And Other Promotional Services To Provide A Onestop Shop To Buyers Sellers Users Amp Professionals It Helps To Find Out Newer Business Opportunities In India Amp Worldwide With 24 X 7 Days Online Access Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promote Direct Interaction Among Members Amp Visitors Backed By Years Of Industry Experience The Company Has Created Cutting Edge In Offering Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training The Reason For Their Accelerated Growth Is Their Technical Experts And Professionals Who Have Vast Amp Practical Experience And Knowledge About The Industry Their Innovative Solutions And Customized Services Have Shown The Way To Growth And Prosperity They Have Achieved A High Level Of Client Appreciation By Understanding Their Requirements And Exceeding Their Expectationspackaging Connections Is Your Instant Single Point Source For Everything Connected To Packaging Directly Or Indirectly Without Using Any Middlemen Exclusive Integrated And Enhanced Contacts On Everything In Packaging Buyers Suppliers User Companies Professionals Packaging Technology Softwarersquos And Much More With Complete Skills And Knowhow Of The Essentials Of The Packaging Industry And The Requirements Of The Clientsnbspmedia Contactnbspanant Chhibbernbsptelnbsp 91 124 4965770email Anantchhibberpackagingconnectionscomnbspfor Further Details Contactamita Venkateshassociate Ndash Scientific Affairs And Consultancyamitavenkateshpackagingconnectionscom Tel Nbsp91 124 4965784nbsp

Schreiner Protech39s Color Laser Film Used In Component And Housing Covers Has Been Awarded The Quothighly Commendedquot Certificate By Finat39s Jury In The Category Of Marketing Final Applications Quotindustryquot The New Specialty Film Came In Third This Year The Further Development Of The Color Laser Film Clf Can Be Custommarked And Cut As Needed For Higher Flexibility Therefore Two Different Laser Systems Are Integrated In A Single Line As This Solution Allows Different Batch Sizes Of Housing Covers To Be Produced For Justintime Delivery Excess Inventories Of Film Variants Or Delivery Bottlenecks Are Avoid

Bosch Packaging Technology New Manufacturing Facility Inaugurated In India Plant Will Support Future Growth In The Region Built On 33000 Square Meters Land In The State Of Goa Investment Of Rs 34 Crores About 5 Million Euro New Facility To Result In Doubling Of Production Capacity In Three Years Verna Ndash Bosch Packaging Technology India Today Announced The Inauguration Of Its New Manufacturing Facility At Verna Goa Built On 33000 Square Meters Land The Plant Was Officially Inaugurated At An Event Presided Over By Shri Manahor Parrikar The Honorable Chief Minister Of Goa And Shri Mahadev Naik The Honorable Minister Of Industries Goa In The Presence Of Mr V K Viswanathan Managing Director Of Bosch Ltd And President Bosch Group In India And Mr Friedbert Klefenz President Bosch Packaging Technology Germany Built With An Investment Of Rs 34 Crores About 5 Million Euro The New Plant Will Fulfill Capacity Expansion And Meet The Increasing Demand Of Indiarsquos Fast Growing Packaging Market As Well As International Markets With The Stateoftheart Technology The New Plant Will Aim At Increased Localization Of New Packaging Machine Production And Make World Class German Technology Affordable And Available To The Indian Market Forceful Growth Plans In India Speaking On The Development Mr V K Viswanathan Said Quotbosch Sees India And The South Asia Region As A High Potential Market For Packaging Technology Particularly In The Pharmaceuticals And Foods Segments This Stateoftheart Manufacturing Facility In Goa Will Meet The Growing Needs Of The Region Through Appropriate Products And Packaging Solutions The New Facility Will Also Generate Good Growth And Employment Opportunities For The People Of Goardquo Setting Up Of The Plant Is A Significant Milestone For Bosch Packaging Technology India That Commenced Its Operations In Verna From A Leased Location In 2007 From A Modest Turnover Of Rs 25 Crores About 400000 Euro In The Year 2000 The Bosch Packaging Technology A Division Of Bosch Limited Has Grown With A 336 Percent Cagr And Registered Sales Of Rs 605 Crores About 10 Million Euro In 2011 And Is Poised To Reach The Landmark Figure Of Rs 100 Crores About 15 Million Euro In The Next Few Years Today Bosch Packaging Technology In India Designs Develops Manufactures And Markets Form Fill And Seal Machines For Flexible Bag Packaging Flow Wrapping Machines For Confectionery And Food Applications As Well As Filling And Closing Machines For Liquid Pharmaceuticals The Subsidiary In India Brings The Global Expertise To The Indian Market Till Date Bosch Packaging Technology India Has Sold Over 1200 Packaging Machines To Leading Names In The Food Confectionery And Pharmaceutical Industries In India And International Markets Bosch Packaging Technology India At Present Employs Directly 130 Associates And With This New Facility It Is Expected To Increase The Number By 30 To About 160 Within The Next Three Years Additionally It Provides Many Indirect Employment Opportunities The Current Production Capacity Of The Plant Is 200 Machines Per Year Which Is Expected To Double In Three Years Ldquoa Milestone For Bosch Packaging Technology In Indiardquo Commenting On The Development At The Inaugurating Ceremony Mr Friedbert Klefenz Said Ldquothis New Facility Will Bring Our New Global Offerings To India It Will Also Contribute Greatly In Pursuing Our Future Plans And Consolidating Our Leadership Position In The Indian And International Markets Hence This Is Not Just A Milestone For The Packaging Technology Division Of Bosch In India But A Global One Toordquo Ldquowe Will Strive To Fulfill Growing Market Needs With The Bestintheindustry Solutions And Strengthen Our Existing Leadership Positionldquo Said Mr Ashok Gourish General Manager Bosch Packaging Technology India

Nbsppackagingconnectionscom Your Ultimate Partner For Indian Marketpackagingconnectionscom Ndashhelps Foreign Packaging Companies Flourish In Indian Marketplacenew Delhi 9thnbspaugust 2012nbsppackagingconnectionscomnbspndash The Leading Online Resource For All Things Packaging Is The Ideal Partner For International Packaging Companies Exploring Indian Industry The Indian Consumer Market Has Shown Strong Steady Positive Growth The Rapid Urbanization And Increase In Consumer Wealth Has Raised Demand For Worldclass Packaging Solutions The Indian Marketplace Is Very Conducive To Foreign Companies Specializing In Packaging The Incredible Wealth Of Local Information Along With A Comprehensive Global Network Makes Packagingconnectionscom The Crucial Part Of Any India Strategymr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom Inviting Mncs Said Ldquothe Indian Market Is Constantly Growing And There Is High Demand For Smart Cost Effective Solutions There Is Tremendous Potential For Foreign Companies In The Field Of Packaging We Help Companies Reach The Right Consumers Find The Best Resources And Adapt The Right Technology To The Indian Marketplace Our Strength Of Knowledge And Network Can Help Global Player Thrive In The Indian Subcontinentrdquo Packagingconnectionscom Has Empowered Many Prominent European Pharmaceutical Companies In Packaging Industry And Helped Fulfil Their India Ambitions The Portal Has Helped World Class Packaging Technology Reach Indian Masses In Cleaner Smarter And More Cost Effective Manner The Portal Is A Global Platform And Is Available In English French German Italian And Spanishvisitnbsphttpwwwpackagingconnectionscomnbspto Learn More About The Indian Packaging Industrynbspabout Packaging Connectionswwwpackagingconnectionscomnbspis Your Destination For Anything In Packagingwwwpackagingconnectionscomnbsphas Its Expertise In Technical Packaging Solutions With Powerful Project Management Skills Coordinate The Whole Project With Designer Vendor And Stakeholders Successful Handling And Implementing Projects On Outsourcing Model Is Their Specializationan Entrepreneurial Company Started By Young But Experienced Packaging Technologist Mr Sandeep Goyal Who Has Worked With Leading Mncs Amp Indian Companies Both As A User And A Supplier Of Packaging Materials From Its Inception The Company Was Powered With An Ultimate Vision To Be A Common Packaging Platform To Connect Professionals From All Across The Globe In Order To Realize This Dream Packaging Connections Has Continuously Strived To Bring The Latest Resources From All Over The World To The Doorstep Of Packaging Industrythe Portal Offers Resources Like Buyer And Seller Offers Pinterviews Innovations Key Decision Maker Direct Contacts Online Reports And Other Promotional Services To Provide A Onestop Shop To Buyers Sellers Users Amp Professionals It Helps To Find Out Newer Business Opportunities In India Amp Worldwide With 24 X 7 Days Online Access Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promote Direct Interaction Among Members Amp Visitors Backed By Years Of Industry Experience The Company Has Created Cutting Edge In Offering Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training The Reason For Their Accelerated Growth Is Their Technical Experts And Professionals Who Have Vast Amp Practical Experience And Knowledge About The Industry Their Innovative Solutions And Customized Services Have Shown The Way To Growth And Prosperity They Have Achieved A High Level Of Client Appreciation By Understanding Their Requirements And Exceeding Their Expectationspackaging Connections Is Your Instant Single Point Source For Everything Connected To Packaging Directly Or Indirectly Without Using Any Middlemen Exclusive Integrated And Enhanced Contacts On Everything In Packaging Buyers Suppliers User Companies Professionals Packaging Technology Softwarersquos And Much More With Complete Skills And Knowhow Of The Essentials Of The Packaging Industry And The Requirements Of The Clientsnbspmedia Contactnbspanant Chhibbernbsptel Nbsp91 124 4965770emailnbspanantchhibberpackagingconnectionscomnbspfor Further Details Contactamita Venkateshassociate Ndash Scientific Affairs And Consultancyamitavenkateshpackagingconnectionscomtel Nbsp91 124 4965784nbsp

Packagingconnectionscom Invites Event Noticesnbspnew Delhi 27th July 20121 Packagingconnectionscom Ndash The Leading Online Resource For All Things Packaging Invites Event Notices And Notifications The Website Offers Organisers To Reach Over 78000 Smart Members The Website Is Home To Innovators Sponsors Businesses Suppliers Recruiters And Specialists In The Field Of Packaging The Portal Is An Excellent Launchpad For Any Packaging Related Eventmr Sandeep Goyal Founder Amp Ceo Packagingconnectionscom Reaching Out To Event Organisers Said Ldquoorganisers And Coordinator Put Incredible Amount Of Effort To Make An Event A Success We At Packagingconnectionscom Are A Great Tool For You To Find World Renowned Packaging Specialists Amp Speakers Sponsors And Reach Your Relevant Target Audiences We Are One Of The Favourite Hotspot Of The Packaging Fraternity This Makes Us The Ideal Notice Board For Finding Quality Content And Connection To Help Make Your Event A Successrdquo Nbspthe Portal Also Features Interviews News Articles Networks To Connect With Buyers And Suppliers Technology And Recruitment And Is Available In English French German Italian And Spanishvisit Httpwwwpackagingconnectionscom To Help Your Event Stand Out About Packaging Connectionswwwpackagingconnectionscom Is Your Destination For Anything In Packagingwwwpackagingconnectionscom Has Its Expertise In Technical Packaging Solutions With Powerful Project Management Skills Coordinate The Whole Project With Designer Vendor And Stakeholders Successful Handling And Implementing Projects On Outsourcing Model Is Their Specializationan Entrepreneurial Company Started By Young But Experienced Packaging Technologist Mr Sandeep Goyal Who Has Worked With Leading Mncs Amp Indian Companies Both As A User And A Supplier Of Packaging Materials From Its Inception The Company Was Powered With An Ultimate Vision To Be A Common Packaging Platform To Connect Professionals From All Across The Globe In Order To Realize This Dream Packaging Connections Has Continuously Strived To Bring The Latest Resources From All Over The World To The Doorstep Of Packaging Industrythe Portal Offers Resources Like Buyer And Seller Offers Pinterviews Innovations Key Decision Maker Direct Contacts Online Reports And Other Promotional Services To Provide A Onestop Shop To Buyers Sellers Users Amp Professionals It Helps To Find Out Newer Business Opportunities In India Amp Worldwide With 24 X 7 Days Online Access Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promote Direct Interaction Among Members Amp Visitors Backed By Years Of Industry Experience The Company Has Created Cutting Edge In Offering Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training The Reason For Their Accelerated Growth Is Their Technical Experts And Professionals Who Have Vast Amp Practical Experience And Knowledge About The Industry Their Innovative Solutions And Customized Services Have Shown The Way To Growth And Prosperity They Have Achieved A High Level Of Client Appreciation By Understanding Their Requirements And Exceeding Their Expectationspackaging Connections Is Your Instant Single Point Source For Everything Connected To Packaging Directly Or Indirectly Without Using Any Middlemen Exclusive Integrated And Enhanced Contacts On Everything In Packaging Buyers Suppliers User Companies Professionals Packaging Technology Softwarersquos And Much More With Complete Skills And Knowhow Of The Essentials Of The Packaging Industry And The Requirements Of The Clientsnbspnbspnbsp

Another Step Closer To Sustainability With The Latest Generation Of The Ltmduo Fold Wrapping Machine Loeschpack Presents Its Top Model The Ltmduo Altendorf 17 Sept 2012 Loesch Verpackungstechnik Gmbh Will Exhibit The Fifth Generation Of Its Fold Wrapping Machine For Chocolate Bars The Ltmduo At This Yearrsquos Fachpack In Nuremberg Ldquowe Have Made Numerous Improvements To Our Top Model Meanwhile We Have Also Developed The First Solutions For Making The Machine Compatible With Biodegradable Packaging Filmsrdquo Says Loeschpack Ceo Andreas Graf From 25 To 27 September In Hall 1 Stand 216 Loeschpack Will Use It Exhibit At The Fair To Focus On Customerspecific Packaging Concepts And Sustainability Loeschpack Will Also Be On Stage To Present Its Innovative Approaches At The Theme Park Ldquopackaging For Medical Technology And Pharmacyrdquo As In Previous Appearances At Fachpack Loeschpack Wants To Position Itself As A Flexible Systems Provider Ldquoat Loeschpack We Want To Make The Best Even Better That39s Why We Have Continued To Further Refine The Marketrsquos Favourite The Ltmduordquo Says Graf As He Expresses His Companyrsquos Mission And Commitment To Innovative Performance Thanks To Close Partnerships And Short Lines Of Communication Between Loeschpack And Its Customers New Packaging Ideas Experiences And Suggestions From The Market Are Efficiently Incorporated Into New And Ongoing Developments While At The Nuremberg Trade Fair Loeschpack Will Present Its First Studies On Fold Wrapping Applications For Compliance Packaging Loeschpack Is Continuing To Extend Its Technology Leadership In Yet Another Innovative Direction Ndash The Processing Of Biodegradable Packaging Film Ldquowe Are Currently Experiencing Promising Results While Testing This Sustainable Packaging And Are Certain That This Technology Will Be Extremely Important For Many Of Our Applications In The Coming Yearsrdquo Comments Andreas Graf As He Explains One Of The New Trends In Packaging At Loeschpack This Level Of Innovation Is The Companyrsquos Latest Step Forward In Its Intensive Efforts Towards Sustainability Loeschpack Already Provides Co2neutral Machines Which Allow The Packaging Machine Manufacturer To Offset The Emissions Caused By Its Machines Through Certified Climate Protection Projects Loeschpack Expects Its Visit At Fachpack In Nuremberg To Be A Huge Success Andreas Graf Ldquowith 1400 Exhibitors And Some 35000 Visitors Fachpack Has Established Itself As One Of Europe39s Premier Trade Fairs Particularly As Regards Technological Innovations In The Packaging Industry While At Fachpack We Will Have The Opportunity To Conduct Constructive Discussions With All The Key Players In The Central European Marketrdquo This Year Marks The 33rd Time Fachpack Has Welcomed Exhibitors And The Public And The Organisers Expect More Positive Growth About Loesch Verpackungstechnik Loesch Verpackungstechnik Gmbh Is An International Manufacturer Of Packaging Machinery And Systems Located In The Upper Franconian Town Of Altendorf As A Subsidiary Of The Piepenbrock Group The Company Offers Integrated Solutions For Customerspecific Packaging Systems At The Same Time Loeschpack Offers The Entire Spectrum Ndash From Semiautomated Or Simplyautomated Entrylevel Solutions To Multilevel Complex System Solutions The Companyrsquos Product Range Includes Packaging Machines For The Food And Nonfood Sectors Loeschpack Is Particularly Specialised In The Packaging Of Chewing Gum Chocolates And Drybaked Goods Loeschpackrsquos Cuttingedge Production Methods And Comprehensive Quality Management Are The Foundation On Which Its Sophisticated Hightech Economical And Highquality Machinery And Equipment Are Built Loeschpack Takes Responsibility Ndash Also For The Environment Through The Use Of Energyefficient Motors And Intelligent Drive Technology The Company Is Able To Deliver Complex Applications With Substantial Energy Savings Under The Label Ldquocarbon Neutral Packagingrdquo Loeschpack Already Offers Customers Co2neutral Machines Any Emissions Released During The Value Creation Process Are Offset Through Climate Protection Projects Ndash And Confirmed By A Certificate Issued By A Neutral Third Party In Addition Loeschpack Plants Trees In Piepenbrock39s Rheinshagen Forest Ensuring Co2neutral Operation Of Its Machines At Customer Sites Discover More About Loeschpack At Httpwwwloeschpackcom Xxxx Characters Incl Xxx Words Discover More About Piepenbrock At Httpwwwpiepenbrockde Captions Bull Picture Ltmduo Loeschpackjpg Ltmduo With Numerous Technical Innovations Bull Picture Company Loeschpackjpg Loeschpack Headquarters In The Upper Franconian Town Of Altendorf Bull Logo Cnp Logo Loeschpackjpg Ldquocarbon Neutral Packagingrdquo From Loeschpack

Nbspindia Has Already Emerged As A Large Consumer Nbspfor Speciality Films And Flexible Packaging Fornbsp Food And Nonfood Applications The Growth Is Being Led By High Growth Fmcg Sector And Retail Revolution Taking Place In Indiathe Speciality Film Sector Has Witnessed A Sustained Growth In Excess Of 15 Compounded Which Will Double Over The Next Four To Five Years This Vibrant Sector Will Call For Innovation And New Investments To Meet The Growing Demand Across A Variety Of End Users To Address The Needs Of Various Industry Segments Like Fmcg And Retailers Speciality Filmnbsp Manufacturers Compounders And Convertors Printers Metallizers And Laminators Chemicalrawnbsp Material Manufacturers And Suppliers Machinery Manufacturers And Suppliers Brand Managers Of Fmcg Food And Dairy Productsnodal Agencies For Design Amp Evolution Of Packing Materials Master Badge Producersnbsp Ink Amp Adhesive Manufacturers Nbspnbspend Consumers Like Consumer Packaging Companies Food And Non Food Sectors Etc First Ever Conference On This Subject Is Being Organized By Chemicals And Petrochemicals Manufacturers Association Cpma And Elite Plus Business Services Epbsnbspthis One Day Conference Is Supported By Indian Plastics Institute Ipiandall India Plastics Manufacturers Association Aipmanbspthe Conference Will Provide A Unique Opportunity To Meet And Network With Experts And Leaders From The Entire Industry Over 300 Delegates Are Expected To Attend This Conference This Will Be The First Time That All Sectors Connected To The Speciality Films And Packaging Sector From Resin Producer To End Users Will Come On The Same Platformvarious Leaders Of The Speciality Films And Packaging Sector And Renowned Speakers From India And Abroad Are Addressing The Conferencenbsp Nbspmain Highlight Of The Conference Are The Distinguished Speakers Representing Global Leaders In Their Field Some The Speakers Will Be As Below Nbspkey Note Speakersnbsp Mr Chitranjan Dar Divisional Chief Executive Of Food Division Nbspnbspnbspnbspnbsp Itc Limited Mr Ulrich Reifenhauser Managing Director Reifenhauser Gmbh Amp Co Maschinenfabrikdistinguished Speakersmr Karan Sehgalnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Euromonitor Mr Roger Kant Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Du Pontnbsp Mr Ajay Bijwe Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Ampacetnbsp Mr Choate Xu Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Basf Mr Nilesh Shah Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Exxonnbsp Mr Carl Johnson Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Gloucester Engineering Usa Mr Raymond Van Hoorn Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Windmoumllleramphoumllscher Germany Mr Kurt L Freye Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Reifenhauserkiefel Extrusion Gmbh Germany Mrhelmey Hassan Nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Davis Standard Mr Jan Homan Nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Constantia Mrnbsp P Dasgupta Nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Itw Ex Hindustan Unilever Ltd Mr S V Mathur Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Max Speciality Films Mr A Venkatrangannbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Paper Products Ltd Mr Pratik Pota Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Nourishco Beverages Ltd Msmamtha Shankarnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Dow Usa Mr Christian Fellnernbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Ngr Austria Mrfabiansiberdtnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Ineos Technologies Mrfranknbsp Bernotat Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Hosakawa Alpine Mr Gustavo Guzzi Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Waterline Switzerland Mrholgerniemeiernbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp Blown Films Mrjeevrajpillai Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp Uflexnbsp Mrmannarmanan Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbsp Nbspnbsp A Schulman Plastics Nbspthe Conference Will Be Beneficial To The Participating Delegates In Areas Such Asmiddothear Top International And National Experts Talk About Key Packaging Technologymiddotlatest Technology Developments Which Can Help Improve Productivity Quality And Outputmiddotunderstanding Business Challenges Facing Participants In The Industrymiddotbenchmark Your Company Against Other Leading Playersmiddotnetwork With Senior Delegates And Expert Speakers From Around The World Nbspfor Registeration Log On Tohttpelitepluscoinspeciality2012registerregistrationphpl For More Details And Complete Program Pl Log On To Httpwwwelitepluscoin Organizers Contact Details Team Elite Plus Business Services 61 Radheya 14th Road Khar West Mumbai 400052 India Office Phonesnbsp912226000556912226000555 Faxnbsp9122 26000556 Emailnbspregisterelitepluscoinnbsp Website Wwwelitepluscoin Nbsp

Edgetrimseriesthe New Edgetrim Has Been Designed Specifically For Use With Blown Film Multilayer Or Mono Layer To Provide Small Energyefficient Nonobstructive Recycling Of Edge Trim Its Compact And Open Construction Allow For Low Maintenance Nonoperator Dependent And Online Operation Ac Vector And Directdrive Technology Keeps Energy Consumption Down Plugs And Sockets Allow For Routine Maintenance To Be Carried Out By The Operator Without The Need To Wait For Dedicated Maintenance Personnel An Air Pelletizing System Is Used For Quick And Easy Access For Cleaning While Eliminating The Problems Associate With Watercooled Systems Film Edge Trim Loose Cutouts Flakes Reels Etcnbspvisit For More Informationhttpwwwpanchalplasticcomproductsextruderextrusionedgetrimrecyclingplant10

Beer Poured At Home From The Draftking Party Keg Made By The Huber Packaging Group Retains Its Freshness For Up To 30 Days As Though It Had Just Been Tapped At A Bar Or Pub Provided The Consumer Buys An Unopened Keg To Guarantee This Schreiner Protech Developed An Authenticity Seal For The Tap Of The 5liter Keg The Specialty Seal Cannot Be Closed Again Unnoticed Once The Keg Has Been Opened And Provides Reliable Authenticity Protection At The Same Time Breweries Can Use The Seal On The Tap For Advertising Their Brands The Objective Of Schreiner Protechrsquos Project Development Was To Achieve A Processstable Authenticity Seal For The Draftking Beer Keg From The Huber Packaging Group Ldquothe Authenticity Seal Has To Be Particularly Sturdy To Withstand The Production Environment Of The Filling Lines And External Cleaning Of The Kegs At The Breweriesrdquo Explained Markus Britsch Business Unit Manager Beverage At The Huber Packaging Group To Qualify The Film The Experts From Schreiner Protech Initially Conducted Material Tests In The Laboratory To Guarantee Rugged Marking And Functional Adhesion Of The Label A Special Adhesive Ensures Reliable Bonding With The Lowenergy Plastic Material Of The Tap The Material Liner And Roll Makeup Were Subsequently Adjusted To The High Cycle Rate Of The Keg Production Line The Label Dispensing System Has To Guarantee Troublefree Application As The Seals Are Dispensed In Parallel To The Fully Automated Production Run Ldquowe Were Involved In The Concept Design Of The Seal Right From The Beginning This Allowed Us To Respond Quickly And Ndash As Needed Ndash Flexibly To The Requirementsrdquo Said Christian Staudt The Responsible Project Manager At Schreiner Protech Breweries Can Also Have The Labels Customprinted With Their Logos And Use Them For Advertising Purposes In This Case Schreiner Protech Preprints The Original Seals With Brand Graphics Using Flexoprinting Technology

All The Advantages Of Compression On Show At Sri Lanka Plast 2012 Sacmi Technology For The Production Of Beverage Caps From 10th To 12th August At The International Plastics Fair With Ccms Continuous Compression Moulding Machines High Output Performance Reduced Energy Consumption No Injection Point Real Time Quality Control Fast Colour Changeovers Economical Size Changeovers Versatility Fast Userfriendly Maintenance And Outstanding Repeatability Are Just Some Of The Advantages Provided By Compression Technology In The Production Of Closures For Mineral Water Fruit Juices Teas And Csds Etc This Technology Will Play A Starring Role At Sri Lanka Plast The International Plastics Exhibition Being Held In Colombo From 10th To 12th August At The Sri Lanka Exhibition And Convention Centre And Will Be Presented By Sacmi At Stand Ndeg 35 A Which Covers Nine Square Metres Taking Centrestage Will Be The Extensive Range Of Presses 24 32 48 64 And 80 Cavities Depending On All The Final Customerrsquos Output Requirements New Solutions Developed By The Group In The Compressionmade Cap Field In Keeping With International Standards And Customersrsquo Needs And Wants A Comprehensive Range Of Closure Systems Is Available In Both The Onepiece And Classic Twopiece Cap Versions These Products Ndash Characterised As Always By Innovative Design And Outstanding Performance Ndash Are Aimed At The Main Largescale Markets Also An Occasion To Get To Know The New Injectiontype Pet Preform Production Systems Thanks To The Innovative Ips This Latest Press From Sacmi Is Characterised By System Flexibility Rapid Size Changeovers Outstanding Ergonomics Energy Savings Reduced Overall Dimensions And A Worldwide Sales And Aftersales Services Network The Colomboheld International Plastic Fair Also Highlights The Local Plastics Industry Market In Which Some 400 Companies Operate Both Internally And Abroad And Illustrates Further Opportunities Offered By The Nearby Markets Sacmi Aims To Play A Pivotal Role In This Dynamic Area And Continue Building On Its Success With Compression Caps Already Widely Appreciated By Major Bottlers And Marketed Extensively The Range In Fact Is Nothing Less Than Vast Covering All The Specific Conditions And Characteristics Encountered In The Various Geographical Areas And Ensuring Excellent Final Product Performance Wherever Required

Global Industry Analysts Gia Recently Published The Printing Inks A Global Strategic Enterprise Report In Which It Predicted That The Production Value Of The Global Printing Ink Market Will Reach Usd182 Billion By 2017 The Report Also Points Out That Asiapacific China And India In Particular Will Enjoy The Fastest Growthexpectations Are That By 2017 The Average Annual Growth Of The Printing Ink Industry In Asiapacific Will Reach 55nbsp The Publication And Commercial Printing Ink Industries Will Be Key Growth Segments For The Region With China And India The Top Performers According To The Report Economic Development In That Part Of The Asian Continent Will Bring About Further Growth Opportunitiesin Many Ways The Printing Ink Industry Is A Microcosm Of Regional And Even Global Economic Development As It Is Closely Linked With Gdp It Fluctuates With The Ups And Downs Of Chinarsquos Economyrecently Thanks To The Depressed Global Economy And Increases In The Prices Of Raw Materials The Global Printing Ink Industry Has Been Under Consistent Price Pressurenbsp Nbspin The Short Term It Is Set To Enjoy Modest Growth As It Trends Towards Highend Digital Technology And Low Energy Costs The Major Demand For Printing Ink Will Continue To Come From The Packaging Commercial Publication And Printing Marketsas Calls For Fast Development And Environment Protection Grow More And More Manufacturers Are Exploring Waterbased Ink Solutions Since 2002 The Total Production Value Of Chinarsquos Printing Industry Has Sustained A Rapid Average Annual Growth Rate Of 154 In 2008 The Domestic Printing Industry Had A Total Production Value Of Rmb 475 Billion Usd 752 Billion Today Of Chinarsquos Approximately 600 Printing Ink Producers 300 Have Sales Revenues In Excess Of Rmb 5 Million Usd 792000 In Their Core Businesses Ndash A Fact Which Points To A Highly Competitive Marketwith The Development Of Highspeed Automated Printing Solutions Revolutionary Changes Abound In The Printing Ink Industry In Response To Environmental Concerns Ecofriendly Inks Like Plant Oilbased Inks And Waterbased Inks Are Growing In Popularity Notably Lithographic Ink Currently Has The Largest Share Of The Ink Market Because Offset Printing Has Unique Advantages Against Other Printing Techniques Digital Printing Ink Too Has Become An Industry Favorite So Much So That By 2017 The Digital Printing Ink Market Will Grow By An Annual Average Of 37 Demand For Digital Printing Ink Will Be Stimulated By Upgrades In Screen Printing Technologies The Widespread Use Of Computers In Commerce The Establishment Of Inhouse Graphic Design Departments And The Proliferation Of Businesses That Offer Instant Printing Servicesnbsp The Expansion Of Digital Printing And Inkjet Printing Will Likely Promote Other Rapid Advancements In The Field Of Digital Printing Inkthe Development Of Environmentfriendly Ink Together With Technical Innovations In Uv And Inkjet Inks Has Driven The Growth Of The Global Printing Ink Marketnbsp At The Same Time Radiation Curable Ink And Energysaving Technologies Have Opened Up Huge Opportunities In The Market While Gravure Ink Screen Printing Ink Letterpress Printing Ink And Other Special Kinds Of Ink Have Enjoyed Rapid Growthnbsp Together These Elements Have Boosted The Market Prospect Of The Printing Ink Industrytoday Thanks To Its Exciting Development Trends Chinarsquos Printing Ink Market Is Attracting International Attention Sinocorrugated South 2012 Will Feature A Zone Dedicated To The Ink Industry Visitors From All Over The World Will Be Able To Assess A Wideranging Variety Of Ink Products Onsiteas Chinarsquos Largest Folding Carton And Packaging Industry Showcase Sinocorrugated South Brings Together Renowned Suppliers Of Corrugated Board Equipment And Consumablesnbsp These Include High Profile Companies Like Gongyao Sky Dragon Printing Ink And Bailide Exhibitors At This Yearrsquos Event Are Set To Display International Standard Carton Boxes Manufacturing Equipment And The Consumablesthe Organizers Of The Show Reed Exhibitions Will Help Exhibitors To Comprehensively Showcase Their Products Technologies And Corporate Logos And Through The Event Provide A Robust Platform On Which Vendors Can Engage With Buyers From All Over The Worldsinocorrugated South 2012 Will Take Place From April 11 To April 13 At The Guangdong Modern International Exhibition Center In Houjie Dongguan

Progress In Development Of Ecosensitive Products Like Uv And Waterbased Varnishing Oilsin Recent Years Uv Varnishing Oil And Waterbased Varnishing Oil For Paper Presswork Are Two Products That Have Seen Significant Growth In Their Popularity In The 1990s The Us And Europe Developed These Products As A Replacement For Paper Coatingnbsp The Two Substances Have Numerous Advantages Including High Efficiency Environment Friendliness And Excellent Gloss These Attributes Have Enabled Paper Uv Varnishing Oil And Waterbased Varnishing Oil To Be Quickly Integrated Into Chinarsquos Printing Industry Especially For Exports To The Us And Europe Nearly All These Exports Feature Uv Varnishing Oil And Waterbased Varnishing Oil Instead Of Traditional Coatingthe Eu Continues To Introduce Environmental Regulations And Stricter Requirements On Materials Used To Produce Gloss Oil As A Result The Materials Formerly Used To Produce Gloss Oil Now Fall Short Of The Regulationsuv Varnishing Oil Producers Have Felt The Adverse Effects Of Soaring Petroleum Oil Prices Consequently They Have Turned To Lowend Environmentally Harmful Materials To Cut Costs This Has Led To The Addition Of Cancercausing Agents Like Benzene To The Oil The Use Of Such Agents Have Slowed The Adoption Of Gloss Oil Made It Less Environment Friendly And Increased The Risk To The Health Of Workers In Oil Production Plantszhongshan Bailide Printing Technology Development Is Part Of The Bailihe Chemical Group And A Manufacturer Of Postpress Processing Materials Operational For More Than 10 Years This Modern Company Specializes In Surface Coating For The Printing Of Paper Packagingnbsp It Has Integrated Development Production And Sales Capacities As Well As Iso90012000 Quality Management System And Qc0800002005 Hazardous Substance Process Management Certifications This Is In Full Compliance With The Strict Environmental Protection Standards To Which Todayrsquos Packaging Printing Industry Must Conformthe Need To Satisfy Us And European Regulations For Environment Protection Has Placed The Company Under Great Pressure From Rising Costs Of The Materials Required To Develop Environmentally Innocuous Green Gloss Oils The Uv2017et1 Uv Varnishing Oil Which Is Virtually Odorless Was Developed To Eliminate The Unpleasant Odor Of Traditional Uv Varnishing Oil The Product Leaves No Residue After Paper Has Been Soaked In Oil And Is Well Suited To Food And Drug Packaging Additionally The Oil Does Not Release Derivatives Of Benzene When It Solidifies This Improvement Eliminates The Risk Of Exposing Printing Industry Workers And Consumers To Harmful Toxins In The Packaged Boxes So Successful Has This Product Been That It Has Even Been Use To Package Renowned Brands Like Nestleacute And Yili Milk Powderbased On Buv2017et1 Bailide Used Its Highend Manufacturing Equipment To Develop The Buv208e1 Padding Uv Varnishing Oilnbsp This Odorless Oil Omits The Waterbased Padding Procedure Thereby Giving Products Excellent Adhesive Qualitiesnbsp It Also Streamlines The Process For Large Scale Printing Companies Who Use Part Of The Uv Machine To Gloss Oilnbsp As A Consequence Less Manual Labor Is Required And The Company Enjoys Reduced Coststhis Type Of Product Is Rmb 01sqm Cheaper Than Traditional Glossing Methods Importantly It Consumes Much Less Electricity Because It Does Not Need Infrared To Dry The Base Oilnbsp This Supports The Lowcarbon Production Goals Set Out By The Government Currently The Product Is In Popular Use By Several Of The Worldrsquos Top Printing Companies Like Rr Donnelleyfor Its Stellar Achievement Bailihe Has Been Awarded The Honor Of Ldquozhongshan Hitech Enterpriserdquo By Zhongshan Technology Bureauin The Innovation Of Waterbased Varnishing Oils Bailide Has Made Great Strides The Company Recently Debuted An Extrahigh Gloss Water Based Varnishing Oil Bsy6302nbsp This Oil Has The Effect Of Common Uv Gloss Oil And Can Reach 85 Degrees After Being Painted Over Just Once It Is Smooth Wearresistant Can Be Used Up To 400 Times And Applicable To All Kinds Of Paperbailide Will Use Sinofoldingcarton 2012 To Promote The Waterbased Matte Gloss Oil Bsy3503 Which Has A Low Matte Degree Good Leveling And Excellent Transparency It Differentiates Itself From Other Products On The Market Through Good Leveling Excellent Transparency Quick Drying And Wear Resistance The Matte Degree Can Reach Six To Eight Degrees And Is Applicable To Any Kind Of Paperbailide Also Has Various Waterbased Gloss Oils With A Diverse Range Of Attractive Attributesnbsp For Example They Pose No Risk They Have No Volatile Organic Compounds They Consume Low Levels Of Nbspenergy They Are Highly Glossy And Extra Wear Resistanttoday Due To Increasing Pressure To Drive Down Costs The Need For Large Companies Like The Bailihe Chemical Group To Be More Socially Responsible And Set An Example For Other Companies In Terms Of Environment Sensitivity Is Key By Each Local Industry Working Under A Ldquobe Professional Serve The Communityrdquo Philosophy Chinarsquos Manufacturing Industry Can Become The World Leaderbailide Will Debut Its Latest Uv Varnishing Oil And Water Based Varnishing Oil Products At Sinofoldingcarton 2012 The Company Looks Forward To Welcoming Visitors At Booth 1e0607 At The Guangdong Modern International Exhibition Center

The Development Of Chinarsquos Corrugated Carton Industry Is Attracting International Attention Statistics From The World Packaging Association Show That The Total Scale Of The Global Packaging Industry Was Usd 5638 Billion In 2009nbsp Of This The Paper Packaging Market Accounted For Usd 216 Billionnbspthe Annual Growth Rate Of Chinarsquos Corrugated Carton Industry In Recent Years Has Been Between 18 And 20 Percentnbsp China Is Expected To Surpass The Us To Become The Worldrsquos Largest Corrugated Carton Market In 2013 As Global Manufacturing Hubs Pool In China The Growth Will Stimulate The Development Of Chinarsquos Corrugated Carton Market Huge Demand Has Thrown Up A Number Of Opportunities For Local Corrugated Roll Manufacturerssinocorrugated South 2012 Which Will Be Held From April 11 To April 13 At The Guangdong Modern International Exhibition Center In Dongguan Has Generated Much Positive Comment From The Industry As Preparations For The Show Have Gathered Pace As Well As Attracting Local Suppliers Of High Profile Brands The Internationalization Of Sinocorrugated South 2012 Is A Key Element Of This Yearrsquos Eventan Increasing Number Of International Corrugated Equipment And Machine Suppliers Are Optimistic About China They Are Confident Of A Strong Market For Their Quality Products After China Implemented The Reform And Opening Up Policy That Allowed For The Introduction Of Foreign Funding Many Of The Worldrsquos Largescale Hitech Manufacturers Built Factories In The Country As A Result Foreign Packaging Machine Manufacturers Also Entered The China Marketat Sinocorrugated South 2012 Renowned Companies Like Bhs Fosberiumlfrac14oelig Mosca And Umetani Will All Exhibit Advanced Practical Options For Manufacturers Whose Equipment Is In Need Of An Upgrade The General Manager Of One High Profile International Manufacturer Noted Ldquothe China Market Is Crucial You Could Describe It As Lsquothe Center Of The Future Worldrsquo Rdquoas Sinocorrugated South Grows In Scale And Influence Numerous International Associations Have Pledged Their Supportnbsp They Include The Asian Corrugated Case Association Acca The Malaysian Corrugated Carton Manufacturersrsquo Association The Federation Of Corrugated Box Manufacturers Of India The Federation Of Corrugated Box Manufacturers Of Andhra Pradesh India The Indonesian Corrugated Cardboard Industries Association The Corrugated Box Manufacturers Association Singapore The Vietnam Packaging Association The Taiwan Paper Container Industry Association And The Hong Kong Corrugated Paper Manufacturersrsquo Association All These Bodies Will Promote Sinocorrugated South 2012 To Their Members And Send Strong Purchasing Delegations To The Event It Is Worth Mentioning Too That The Acca Will Hold Its Annual Conference At The Exhibition As An Additional Show Of Support For The Event The Acca Will Also Send Conference Delegates To Visitas It Matures Sinocorrugated Is Attracting More Attention From International Trade Media Reed Exhibitions The Eventrsquos Organizers Work Closely With Media Outlets From As Far Afield As Germany Spain Italy The Ukraine Russia The Middle East Malaysia India Indonesia And Pakistan As Well As Those From Hong Kong And Taiwan To Share The Latest Event News With The Global Corrugated Industry Sinocorrugated South 2012rsquos Extensive Exhibiting Area Strong Profile Of Exhibitors And Diversity Of Advanced Equipment For Display Have Been Major Media Talking Points Nbspnbspa Number Of Trade Journalists From Some Of These Outlets Are Expected To Attend The Showto Expand The Global Influence Of Sinocorrugated South 2012 The Organizers Sent A Team To Promote The Event At Corruexpo India In New Delhi Last December The Exercise Was A Success As Many Industry Professionals Inquired About Sinocorrugated South And Over 300 People Filled Out Visitor Preregistration Forms Onsite The Indian Corrugated Industry Association Confirmed Its Intention To Send Delegations To The Show A Number Of High Profile European Exhibitors At Corruexpo Also Expressed An Interest In Sinocorrugated South This Went Some Way To Proving Sinocorrugated Southrsquos Growing Stature On The International Stage As A Onestop Purchasing Platform It Is A Big Draw For International Visitorsnbsp

Printech Participated In The Saudi Print Pack Exhibition From Nov 28 To Dec 1 At The Riyadh International Exhibition Centermr Pankaj Patel Managing Director Says Ldquothe Customer Response We Received At Our Stand Was Really Good With Major Potential Customers Visiting Our Stand And A Generation Of Machine Sales Worth About 1 Million Riyals In The Following Weekrdquonbspnbspprintech Took This Opportunity To Announce The Launch Of Their New Industrial Packaging Division With A Live Demo Of Automatic And Semiautomatic Stretch Wrapping Machines From Robopac Italy And Automatic Strapping Machines From Mosca Germany At Their Standwith The Result Of A Sale Of 2 Machines With 3 More Machines In Final Stages Of Sale Label Customers Showed Keen Interest For Label Converting Machines From Prati Like Their Latest Range Of Slitterrewinders With 100 Defect Detection Systems From Nikka Japan Amp Bst Germanyrsquos Ldquosharkrdquo System A Good Set Of Customers Were Interested In Booklet Labels For Pharmaceutical And Other Industries For Which Prati Has The Best Solution Ldquovegardquo And Ldquovega Plusrdquo Machines Nbsptwo Customers Are Already In Discussion For The Purchase Of This Machinethe Response For Av Grade Hot Foil Stamping From Api Foils Uk Was Really Good Nbspthese Foils Can Be Used On Leather Plastic Velvet Wood And Difficult Substrates Nbspthis Is The Main Film Used For A Majority Of Holy Qurans Printed In Saudi Arabia Nbspmany Customers Are Also Interested In Trying The New Cold Foil Technology For Offset Printing Presses Which Are Available In Overprinting Grade As Well As Nonoverprinting Grade Nbspthere Are Already 4 Cold Foil Installations In Saudi Arabia Which Api Currently Supplies To Nbspfor The Label Industry Api Is Also The Market Leader In Cold Foil For Flexo Printing Process For Which It Is A Dominant Playernbspwith An Aim To Reduce Printing Process Wastage By At Least 40 Printechrsquos Focus For The Year 2012 Is To Work With The Help Of Bst Germany Towards This With Its Customers Nbspthis Can Be Achieved With The Help Of Bst Super Handy Scan 4000 Amp Bst Premius Web Inspection Cameras Which Provide Defect Detection During Printing Color Monitoring Bar Code Reading Printing Machine Functions Nbspbst Also Offers Ldquoshark 3000rdquo A State Of The Art 100 Defect Detection Camera By Which A Flexible Packaging Converter Can Guarantee 100 Defect Detected Material To Their End Users Nbspthis System Is A Must For Pharmaceutical Companies And Preferred By Mncs Like Proctor And Gamble Unilever Etca Few Major Stretchwrapping Film Manufacturers From The Region With Ultra Stretch Or High Stretch Ability Film Of More Than 250 Stretch Ability Are Under Discussion To Test Their Film On Special Robopac Machines From Robopac Italythe Laser Marking Machine From Macsa Spain Displayed At The Printech Stand Evinced A Lot Of Interest And Inquiries From Customers From Varied Industries Like Pet Water Bottle Manufacturers To Companies In Plastic Glass Paper Plastic Cables And Metal Can Industries Nbspthe Key Advantage Of Using This Laser Marking Machine Is That There Is No Requirement For Consumables No Spillage Of Hazardous Chemical Ink These Machines Are Zero Maintenance Nbspmany Large Manufacturers Like Dairies Bakery Firms Beer And Juice Manufacturers Mineral Water Manufacturers Said That They Were Impressed By The Quality And Complete Range Of Transmission And Timing Belts Supplied By Esbelt Spain Through Printech Nbspprintech Has Invested In A Belt Joining Facility With Which They Can Supply Any Size Of Belt As Per Customer Specifications Within 3 Working Daysmany Corrugated Carton Customers And Box Packers Expressed Their Interest In The Fully Automatic And Semi Automatic Machines From Mosca Germany For Carton Strapping Pallet Strapping And Concrete Block Strapping Solutions For Manufacturing Industries Like Ceramic Industries Corrugated Carton Industries Concrete Block Manufacturers And A Variety Of Other Industriesprintech Middle East Is A Complete Solutions Provider For The Printing And Packaging Industry In The Mena Middle East North Africa Region And India We Provide Consulting And Technical Solutions To Our Partners In Terms Of Equipment Components And Consumables To Enhance Throughputissued Bynbspprintechmephonenbspnbsp971 4 2678385nbspnbspnbsp Faxnbsp971 4 2678386addressnbspal Qusais Industrial Area 4 Dubai Uaenbspnbsppo Box 48251 Dubai Uaecitytownnbspal Qusaisstateprovincenbspdubaicountrynbspunited Arab Emiratesnbsp

Schreiner Medipharm Has Developed The New Pharmacushion Label Specifically For Transporting Pharmaceutical Glass Containers The Intelligent Label Protects The Sensitive Vials From Glass Breakage By Means Of An Integrated Special Layer Which Avoids The Need For Complex Secondary Packagingthe Pharmacushion Label By Schreiner Medipharm Is Equipped With A Foam Layer On The Back Of The Label That Wraps Around The Glass Container Like A Protective Cushion This Allows The Vials Filled With Pharmaceuticals To Be Transported In Boxes Without Any Additional Packaging And To Reach The Recipient Undamaged In Addition To Preventing Financial Losses This Solution Minimizes Health Hazards As Certain Preparations Harbor The Risk Of Releasing Toxic Substances Through Damaged Vials The Consistent Integrity Of The Container Is Ensured As Well Which Avoids Contamination Of The Drugs Inside The Container Furthermore The Label Prevents Contamination Of Other Packaging Materials By Liquids Escaping From The Container And Last But Not Least Protects Healthcare Personnel From Injuries That May Be Caused By Broken Vialsthe Front Of The Label Serves To Mark The Containers The Thin And Flexible Material Structure Allows Easy Application Of The Pharmacushion Label To The Glass Container Thanks To This Intelligent Combination Of Marking And Protection Pharmaceutical Manufacturers Are Provided With An Efficient And Ecoconscious As Well As Economical Solution That Significantly Facilitates The Safe Transportation Of Glass Containers In Large Batches

Wwwpackagingconnectionscom Is The Common Packaging Platform To Connect Professionals From All Across The Globe It Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promotes Direct Interaction Among Members Amp Visitor Mr Amninder Singh Of Packagingconnections Would Be Presenting The Conference Paper On Packaging Innovations Cdmc Is An Exhibition And Conference Which Covers The Whole Aspects Of Making Of Cosmetics And Detergents And Taking Products From Bench To Consumer It Is Supported By Major Associations Such As Ihpcia India Home Personal Care Industry Association Iwin Indian Women Industry Network And Leading Industry Publications This Support Will Deliver A Cuttingedge Conference Program And A High Degree Of Professional Interaction And Communication In The Markettalking About Cdmc Mr Sandeep Goyal Ceo Packagingconnectionscom Said Ldquowe Are Truly Excited To This Focussed Show As This Will Help Us To Fulfil Our Commitment Of Supporting Foreign Packaging Companies In India In This Show We Would Be Showing The Innovative Fragrance Amp Perfumery Glass Containers Of Heinzglas Germanyrdquocdmc 2012 Nbspexhibiting Segmentsnbspmiddotnbspnbsp Processingmiddotnbspnbsp Nbsppackagingmiddotnbspnbsp Nbsplabellingmiddotnbspnbsp Nbspcontract Manufacturemiddotnbspnbsp Nbsplaboratory And Testing Equipmentmiddotnbspnbsp Nbspregulatory Environmentmiddotnbspnbsp Nbspmarket Researchmiddotnbspnbsp Nbspcreative Servicesmiddotnbspnbsp Nbspconsultant Dropin Centrenbspnbspnbspnbspabout Packaging Connectionspackagingconnectionscom Is Your Destination For Anything In Packagingan Entrepreneurial Company Started By Young But Experienced Packaging Technologist Mr Sandeep Goyal Who Has Worked With Leading Mncs Amp Indian Companies Both As A User And A Supplier Of Packaging Materials From Its Inception The Company Was Powered With An Ultimate Vision To Be A Common Packaging Platform To Connect Professionals From All Across The Globe In Order To Realize This Dream Packaging Connections Has Continuously Strived To Bring The Latest Resources From All Over The World To The Doorstep Of Packaging Industrythe Portal Offers Resources Like Buyer And Seller Offers Pinterviews Innovations Key Decision Maker Direct Contacts Online Reports And Other Promotional Services To Provide A Onestop Shop To Buyers Sellers Users Amp Professionals It Helps To Find Out Newer Business Opportunities In India Amp Worldwide With 24 X 7 Days Online Access Keeps You Informed About The Latest Packaging Developments Around The Globe Every Week And Promote Direct Interaction Among Members Amp Visitors Backed By Years Of Industry Experience The Company Has Created Cutting Edge In Offering Packaging Solutions For Healthcarepharmaceutical Industries Foods Amp Beverages And Customized Training The Reason For Their Accelerated Growth Is Their Technical Experts And Professionals Who Have Vast Amp Practical Experience And Knowledge About The Industry Their Innovative Solutions And Customized Services Have Shown The Way To Growth And Prosperity They Have Achieved A High Level Of Client Appreciation By Understanding Their Requirements And Exceeding Their Expectationspackaging Connections Is Your Instant Single Point Source For Everything Connected To Packaging Directly Or Indirectly Without Using Any Middlemen Exclusive Integrated And Enhanced Contacts On Everything In Packaging Buyers Suppliers User Companies Professionals Packaging Technology Softwarersquos And Much More With Complete Skills And Knowhow Of The Essentials Of The Packaging Industry And The Requirements Of The Clientsnbspnbsp

The Thm 1648 From Oystar Hassia Is Distinguished By Its Flexibility Reliability And High Rate Of Efficiency The Ffs Machine At Ak Gida Will Be Able To Produce 54000 Cups Agrave 45 Grams Per Hour At A Nominal Output Of 30 Strokes Per Minute The Cups Ndash Manufactured In 6pack Units 30up Format Ndash Are Filled With Quotpetit Suissequot A Cream Cheese Product Made Of Pasteurized Cowrsquos Milk Enriched With A Wisp Of Cream The 6pack Units Are Provided With Perforated Snaplines To Allow The Cups To Be Separated Easily The Tool Is Designed For Quotlow Wastequot Perforation Trimming And Starshaped Punchingto Ensure The Quality Of The Product The Thm 1648 Comes In The Quothygienic Activequot Version For An Active Disinfection Of The Bottom Web And Lid Material After Steam Disinfection The Wrapping Materials Are Passed On In A Sterile Tunnel With Sterile Air Overpressure And The Cups Are Then Sealed Hermetically In Addition A Membrane Valve Dosing System Cipsipcapable In Aseptic Design Featuring 30 Filling Nozzles Is Integrated And A Gas Flushing Of The Cup Headspace Takes Place This Ensures That The Highest Hygienic Demands Are Met And Guarantees An Optimal Product Protection With The Bestpossible Quality Assurancewith The Sale Of This New Machine Oystar Hassia Continues To Expand On The Strong Business Relations It Enjoys With Longterm Customer Ak Gida The Food Manufacturer Had Already Purchased An Aseptic Machine For Its Pudding Production In 2003 Two Additional Machines Followed In 2007 A Stick Pack Machine For Chocolate Sauce As Well As An Additional Ffs Machine For The Production Of Cream Cheese

Tricorbraun Has Named Charles J Pfister Chief Financial Officer According To Keith J Strope Company President And Chief Executive Officer Mr Pfister Will Be Responsible For The Firmrsquos Finance Corporate Administration And Human Resource Groups He Will Be Based In The Firmrsquos St Louis Headquarterstricorbraun With Sales Of Almost 1 Billion Is One Of North Americarsquos Largest Providers Of Jars Bottles And Other Rigid Packaging Componentsprior To Joining Tricorbraun He Had Been Senior Vice President Of Finance For Kohlrsquos Corporation Nysekss At Kohlrsquos Mr Pfister Was Responsible For Financial Planning And Analysis As Well As The Companyrsquos Treasury Tax And Investor Relations Departments He Was Employed At Kohlrsquos From 2008 To 2012from 2001 To 2008 Mr Pfister Was A Vice President For The Home Depot Nyse Hd And Was Most Recently In Charge Of Corporate Financial Planning And Analysis And Indirect Procurementmr Pfister Graduated From The University Of Illinois Urbana In 1987 Where He Earned A Bachelor Of Science Degree In Economics With An Emphasis In Accounting He Became A Certified Public Accountant In 1989